Conserved Protein Domain Family
Peptidase_M9_N

?
pfam08453: Peptidase_M9_N 
Peptidase family M9 N-terminal
This domain is found in microbial collagenase metalloproteases to the N-terminus of pfam01752.
Statistics
?
PSSM-Id: 400655
View PSSM: pfam08453
Aligned: 35 rows
Threshold Bit Score: 188.214
Threshold Setting Gi: 293328781
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q7MFW4            61 CtaTQLIADT-SSFASQIANADYDCMSSWFSTSQIEADALFSEQNLALVNEALLETVNQYQGEEKTAkhIYYLAEFIKAA 139  Vibrio vul...
tigr:NT01CX1295   48 YsiGELEKLSnEKLIDTLSKIKWNDITDFMQYNDGARKFYSDYSRVQAIINAIKERGSQYTEENDKG--IPTLIEVLRAG 125  Clostridiu...
Q81NB3            93 YtlAELNKMPnSELIDTLSKISWNQITDLFQFNQDTKAFYQNKERMNVIINELGQRGRTFTKENSKG--IETFVEVLRSA 170  Bacillus a...
tigr:GBAA_0555    94 YsmADLNKMNnQELVETLGSIKWHQITDLFQFNEDAKAFYKDKGKMQVVIDELAHRGSTFTKDDSKG--IQTFTEVLRSA 171  Bacillus a...
Q81BX8            94 YsmAELNQLNnKQLTDLLVTIKWYQIPELFQFNSDSLKFYQDDSRMQAIINKLAEQGQAYTQDDSKG--IETLVEALRAA 171  Bacillus c...
Q81AN3            90 YtiAELNQLSnQQLVDLLVTIDWEQITGLFQFNTDSLAFYQNDSRMQAIIDKLKQQGQAYTKDDSKG--IETLVEVLRSG 167  Bacillus c...
CAL83155          73 YsfNDLNKLSnKEILDLTSRIKWNDISDLFQYNDDSYAFYSNKERVQALIDGLYEKASTYTGTDDKG--IDTLVEILRSG 150  Clostridiu...
Q56696            31 CavADLQQS--RDLAAAVSGAEYDCYHAWFSAPSATLNDIYSEASLSRIQVALDQEIARYRGEAEQArvLENLGEFVRAA 108  Vibrio par...
Q9KRJ0            31 CeiQDLQPA--RDLPAQIAVATQACYNSWFYAPTATLDNLYSEASLAHLQTVLDAEIARYTGEAQQArrLENYGEFIRAA 108  Vibrio cho...
Q7MBR8            35 CdvAQLQQS--PDLAAAISSADYACYSGWFSAPSDTLNSIYSEASLSRVQVALHQAVQTYQGEAEQAraIENLGEYVRAA 112  Vibrio vul...
Q7MFW4           140 YKNRHDTyARKIAPFS-TELSQNIATTSATFLRNTHALEMGDEQMKALGSMLIIVDSVRQLHIAASDVFALLNQFEQRLT 218  Vibrio vul...
tigr:NT01CX1295  126 FYLGFYN--KQLSDFDsIKYKERCIPAINSVINNSNFKLGTPCQNEIIKSVGLLISNTTCDEKIVNKLTPILVQYNSNVD 203  Clostridiu...
Q81NB3           171 FYVGYYN--NELSYLKeRSFHEKCLPALKAIAKNPNFTLGTAEQDRVVAAYGKLIGNASSDTETVQYAVNVLKQYNDNLT 248  Bacillus a...
tigr:GBAA_0555   172 FYLAFYN--NELSELNeRSFQDKCLPALKAIAKNPNFKLGTTEQDTVVSAYGKLISNASSDVETVQYASNILKQYNDNFT 249  Bacillus a...
Q81BX8           172 FYLGFYH--DELSKLNeRSYHDKCLPALKTIAKNPNFKLGTSEQNKVIASYGKLIGNASADVETVLYAGEIFKQYNDNLA 249  Bacillus c...
Q81AN3           168 FYLGFYN--SELSKLNeRSYHDKCLPALKAIANNSNFKLGTLEQNRVVSSYGKLIGNASSDVETITSAAKIFKQYNDNFS 245  Bacillus c...
CAL83155         151 FYLGFYN--DSLKYLNdRSFQDKCIPAMLAIENNKNFKLGEKGQDTVISALGKLIGNASCNAEVVNKTVPILEQYYREMN 228  Clostridiu...
Q56696           109 YYVRYNA-GTGTPEFS-EALSQRFAQSTNLFLNNPHALDQGREQVGAMKSLTLMVDNVKQLPLTMDSMMAALMHFNRDTA 186  Vibrio par...
Q9KRJ0           109 YYVRYNA-GR--EPYS-QALSQRFAQSIDRFLRHPHAFDQGREQVGAMKSLSLMVDNVKQLPLTMDAMILALHRFNRETA 184  Vibrio cho...
Q7MBR8           113 YYVRYNA-GN-VAAFS-DLLGQQFAHTINAFLANPHALDQGREQVGAMKSLTLMVDNVKQLPLTMDAMMLALQQFNPETA 189  Vibrio vul...
Q7MFW4           219 ENYYYRKAINNIFVAMAGHSQSDDFY 244  Vibrio vulnificus YJ016
tigr:NT01CX1295  204 ENVKDYTKGQAIYNIIEGVSYSIESY 229  Clostridium novyi NT
Q81NB3           249 TYVSDYAKGQAVYEIVKGIDYDIQSY 274  Bacillus anthracis
tigr:GBAA_0555   250 TYVNDRMKGQAIYDIMQGIDYDIQSY 275  Bacillus anthracis str. 'Ames Ancestor'
Q81BX8           250 TFIEDRTKGDAIYELMKGIDFDIQTD 275  Bacillus cereus ATCC 14579
Q81AN3           246 TLVDNLSAGNAIYDIMQGVDYDIQSY 271  Bacillus cereus ATCC 14579
CAL83155         229 KYPKDKLKADAVYSLMKEINYDISQY 254  Clostridium botulinum A str. ATCC 3502
Q56696           187 KDTQWVDGLNNLFRSMAGHAANDAFY 212  Vibrio parahaemolyticus RIMD 2210633
Q9KRJ0           185 QDTQWVDGLNNLFRAMSGHVGNSEFY 210  Vibrio cholerae O1 biovar El Tor str. N16961
Q7MBR8           190 KNTQWVDGLNNLFRSMAGHIANDAFY 215  Vibrio vulnificus YJ016
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap