Conserved Protein Domain Family
A_deaminase_N

?
pfam08451: A_deaminase_N 
Adenosine/AMP deaminase N-terminal
This domain is found to the N-terminus of the Adenosine/AMP deaminase domain (pfam00962) in metazoan proteins such as the Cat eye syndrome critical region protein 1 and its homologs.
Statistics
?
PSSM-Id: 400654
View PSSM: pfam08451
Aligned: 19 rows
Threshold Bit Score: 91.1968
Threshold Setting Gi: 74857425
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q2M0I1                9 GLFMCVCpdpvesrtrnknvaerrlmslygntphveallGRSRPTPDTYKTLRNAFFRYEESRSLGYDLELTDRELQANE 88  Drosophi...
EEN52642             10 MFLACALphv-------------------------------kaETKSDFLNARANLLSLEHGLKTGGDLALDDVEQAVNK 58  Florida ...
Q553U5               18 VFNGLIVnsknihinnknnnnn---nnnkdlsssesgssSDINPYISQYNSERETLVNQENQIKLGSNTPFNSKEQQANT 94  Dictyost...
EDV96207             72 LALLWTVyls---------------------------vdYYSCTTEQRFAQMRQDFVVKERRRRLGGSLGLTPLEEVANQ 124 Drosophi...
WGS:AANI:GJ13086-PA  66 LALVWTVyls---------------------------vdYYSCSPEQRFARLRQDFLMRERRRRVGGKVKLNPLEEIANE 118 Drosophi...
WGS:AAPU:GI12943-PA  72 LALVWTVyls---------------------------vdYYACTQEGRFEKMRHDFLTRERLRRVGGKLKLTDFEEMANG 124 Drosophi...
XP_002021239         66 VAMFFLTpl-----------------------------kDLQATPEELFARKHHSMVAKEQRMQVGGKLNLSPLEEMANA 116 Drosophi...
XP_001957708         79 VLFCAAPigq---------------------------ddLLDKSTAERLERQRRYFEAKEERLRLGGRMEMSPLEEVANG 131 Drosophi...
EDW24998              3 LGLLLCLvpp---------------------------llGGLHAADLPYETLREQIMEAERLASLGGNIWLTSDEEKANS 55  Drosophi...
XP_002058516          9 WLLQL----------------------------------GQLRGADLPYETLRERIMKAEQMASLGGNLWLTADEEKANS 54  Drosophi...
Q2M0I1               89 TIMAAKLHEYTEGLLTPHLFKPAQHIFDVLDGI-RDTQLFHFL 130 Drosophila pseudoobscura
EEN52642             59 VLMALKVKEL-DTALGSGSFPPSTHFFHAKSAI-EQSKVFQFI 99  Florida lancelet
Q553U5               95 IFLNILQN---EELSFSNNDPSGVNFFIEKQIIeNESTIFKII 134 Dictyostelium discoideum
EDV96207            125 RLLAIKRVDE-EMHQIWSDYQPRPH-FLAKYQI-NETDLYSAL 164 Drosophila grimshawi
WGS:AANI:GJ13086-PA 119 RLLAIKQVDE-ELHHIWSDYQPRPH-FLAKYKF-NETDLYSVL 158 Drosophila virilis
WGS:AAPU:GI12943-PA 125 RLLAIKQVDE-EMHNIWSDYQPRPH-FLSKYKI-NETDLYSVL 164 Drosophila mojavensis
XP_002021239        117 RL--VKQADM-EVQRLWVNYSSNTPQFLKDHKI-SETDLYGML 155 Drosophila persimilis
XP_001957708        132 RLMAVKMVDD-EVHNLWKNYHSQPPPFLRHHNI-SETDLYGLL 172 Drosophila ananassae
EDW24998             56 ILMNAKRAEIAEGIKTPEKYPPAMHFFQGRQYV-RQSEVFRFI 97  Drosophila persimilis
XP_002058516         55 ILMNAKRAEIAEGIKHPEKYAPAMHFFQGKQFV-RQSEVFRII 96  Drosophila virilis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap