6G20,3ZQ5,5NM3


Conserved Protein Domain Family
PAS_2

?
pfam08446: PAS_2 
Click on image for an interactive view with Cn3D
PAS fold
The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.
Statistics
?
PSSM-Id: 400652
View PSSM: pfam08446
Aligned: 24 rows
Threshold Bit Score: 115.816
Threshold Setting Gi: 75405513
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6G20_B    13 CDREPIHIPGYIQPHGCLIACDNAMRMVLRHSENCGELLGL-EGDLNGRTAEDVLGKRLVHDLRNALTVTGKTTRPAMLP 91   Agrobacterium fabr...
ACJ00586 160 CEQEDIRRVGAIQPWGAVLAVDPRDWTVCAASDNAQALLDCa-RPPLGRPLGEVLDAGPLAALRDWLPDRTSRS----WR 234  Rhodospirillum cen...
Q8VUB6    18 CEREQIHLAGSIQPHGILLAVKEPDNVVIQASINAAEFLN--TNSVVGRPLRDLGGDLALQILPHLNGPLHLA---PMTL 92   Bradyrhizobium sp....
Q88HJ2    12 CDREPIQIPGSIQPHGCLLACDASATVVLRHSVNAPQMLGV-ANDINGQKLHAVLGDEVTHTLRNALARTRDASRPALSF 90   Pseudomonas putida...
Q882H5    21 CAREPIRIPGAIQPHGVLLSVAGDPLCIEQVSANCAKSLGLeSAELLGQPLSILLSAAHSMLINQAYSQPAMPNSDPIRL 100  Pseudomonas syring...
Q885D3    16 CADEPIQFPGAIQPHGLLFTLKEPELTILQVSANVQSVLGKvPDQLAGQTLDCVLGAGWAEVIRSTSANDSLVDVPRLLM 95   Pseudomonas syring...
Q9R6X3    17 CSKEPIHIPGLIQPHGVLLVLQEVDLTILQVSNNTFNILGRhPEQLLNQHLSCLLEAEQLSLLKDCLAQEDLQIINPLEF 96   Nostoc sp. PCC 712...
3ZQ5_A    15 LETLAIHTAHLIQPHGLVVVLQEPDLTISQISANCTGILGRsPEDLLGRTLGEVFDSFQIDPIQSRLTAGQISSLNPSKL 94   Synechocystis sp. ...
Q9LCC2    15 LKEAPIHLSGQIQPHGVLLVLEEPGLKILQVSNNTWGILGInAENILQKKLEDLLDSFQIERIQSGLSSGNLEFINPTKI 94   Nostoc sp. PCC 712...
Q3IV48    13 CEMEPIATPGAIQPHGALMTARADSGRVAHASVNLGEILGLpAASVLGAPIGEVIGRVNEILLREARRSGSET---PETI 89   Rhodobacter sphaer...
6G20_B    92 AmETS---DGRSFDISLHR-YKSTTIIEFEPS 119  Agrobacterium fabrum str. C58
ACJ00586 235 G-EMA---RGRRIDIRAHR-SGGCVVLDLEPl 261  Rhodospirillum centenum SW
Q8VUB6    93 RcTVGs--PPRRVDCTVHRpSNGGLIVELEPA 122  Bradyrhizobium sp. ORS 278
Q88HJ2    91 GvTLP---NGAAVDIAAHL-YKGTAILEFEPA 118  Pseudomonas putida KT2440
Q882H5   101 Tv------RAVDYNASLSR-AGDVLIIELEPF 125  Pseudomonas syringae pv. tomato
Q885D3    96 Sv------EGVEFEALLHR-SQEALVLELEIQ 120  Pseudomonas syringae pv. tomato
Q9R6X3    97 IiKSHn--ESISFDVIAHR-SNNLLILELEAN 125  Nostoc sp. PCC 7120 = FACHB-418
3ZQ5_A    95 W-ARVmgdDFVIFDGVFHRnSDGLLVCELEPA 125  Synechocystis sp. PCC 6803
Q9LCC2    95 W-IRKkgdDYAVFDAVFHRnTEGFLILELEPA 125  Nostoc sp. PCC 7120 = FACHB-418
Q3IV48    90 GsFRRs--DGQLLHLHAFQ-SGDYMCLDIEPV 118  Rhodobacter sphaeroides 2.4.1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap