1SQH


Conserved Protein Domain Family
FR47

?
pfam08445: FR47 
Click on image for an interactive view with Cn3D
FR47-like protein
The members of this family are similar to the C-terminal region of the D. melanogaster hypothetical protein FR47. This protein has been found to consist of two N-acyltransferase-like domains swapped with the C-terminal strands.
Statistics
?
PSSM-Id: 117022
View PSSM: pfam08445
Aligned: 9 rows
Threshold Bit Score: 92.0074
Threshold Setting Gi: 47169190
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1SQH_A 211 SLGICRS--DTGELIAWIFQNDF-SGLGXLQVLPKAERRGLGGLLAAAXSREIARgEEITLTAWIVATNWRSEALLKRIG 287 fruit fly
Q9VR30 196 GLGIFRK--ETGELAAWMVHSYY-GAMFSMQTRPDFRRMGYGIRLAKSLTQLVIE-RGYTPFVVIRPGNDASRSLYTKLG 271 fruit fly
Q96XA1 146 VYGLFLGnrLVSAAYTWIETRDV-GIIGGVLTREEFRNRGFASSVVSQLTEDIVK-RGKIASLYVREDNTPAIHVYKKIG 223 Sulfurisphaera tokodaii
Q82NK7 198 YLGIRRGg-ALVAMAGERLHPPGwTEISAVCTDPEFRGEGLAGRLVLAVAHGIRE-RGETPFLHTGAGNTNAIRLYEALG 275 Streptomyces avermitilis
Q826I2 145 YLGIRHRg-RLIAMAGERLRPPGwTEISAVCTHPDHRGRGLATRLVRAVAAGIRE-RGDTPFLHAAASNTTAIRLYESIG 222 Streptomyces avermitilis
Q9VLU3 179 NLGAYD---DKGKLVAWCLRLPI-GSLGLLQVLESHKRLGLGSLLVKSMAKKISA-AGDQVLAPVVTKNTPSRSMFEKLG 253 fruit fly
Q9VJ98 187 SVGLYQE--DTQELVAWCIRLQG-GYLGALQVKDTHKRRGFGSVVTREIAYRLAV-QGHDVMALVGPSNKPSSEMFSKLG 262 fruit fly
Q9VJA0 189 NVGLYEK--ELGSLCAWCLRLQS-GFLGALEVLPTHQRRGLGLVVAAAISKAIATdLQQDITALVNINNSAACRVFEKLN 265 fruit fly
Q5L1D1  66 VVGFVSG--GPNRAADGLIAKYD-GELYAIYLLKEVQGKGLGRQLVQALIRHLAQ-KGIHSLVVWVLADNPSRGFYERLG 141 Geobacillus kaustophilus
1SQH_A 288 YQKD--LVNEWI 297 fruit fly
Q9VR30 272 YEKA--FETCRV 281 fruit fly
Q96XA1 224 FIEY--WKRLWV 233 Sulfurisphaera tokodaii
Q82NK7 276 FRLR--RTTRFL 285 Streptomyces avermitilis
Q826I2 223 FTLRraTESVRV 234 Streptomyces avermitilis
Q9VLU3 254 FRAI--DNTYWA 263 fruit fly
Q9VJ98 263 FQVI--DQCYWL 272 fruit fly
Q9VJA0 266 FRLIqdEHYYWS 277 fruit fly
Q5L1D1 142 GEKL---AEERV 150 Geobacillus kaustophilus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap