Conserved Protein Domain Family
Gly_acyl_tr_C

?
pfam08444: Gly_acyl_tr_C 
Aralkyl acyl-CoA:amino acid N-acyltransferase, C-terminal region
This family features the C-terminal region of several mammalian specific aralkyl acyl-CoA:amino acid N-acyltransferase (glycine N-acyltransferase) proteins EC:2.3.1.13.
Statistics
?
PSSM-Id: 117021
View PSSM: pfam08444
Aligned: 8 rows
Threshold Bit Score: 166.468
Threshold Setting Gi: 74731045
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q5RFP0 207 CCLLGPEGTPVCWDLMDQTGEMRMAGTLPEYRLHGLVTYVIYSHAQKLGKLGFPVYSHVDYSNEAMQKMSYTLQHVPIPR 286 Sumatran orangutan
Q5PQT3 207 SCVLGPEGTPASWTLMDQTGEMRMGGTVPQYRAQGLVSFVIYSQDQIMKKRGFPVYSHTDKSNTVMQKMSYSLQHLPMPC 286 Norway rat
Q8WU03 202 FGVLGPEGQLVSWIVMEQSCELRMGYTVPKYRHQGNMLQIGYHLEKYLSQKEIPFYFHVADNNEKSLQALNNLGFKICPC 281 human
Q969I3 208 ACMLGPEGVPVSWVTMDPSCEVGMAYSMEKYRRTGNMARVMVRYMKYLRQKNIPFYISVLEENEDSRRFVGQFGFFEASC 287 human
Q9DCY0 206 FCIMGPEGTPVSWTLMDHTGELRMGGTLPKYRRQSLIYHVASQQIQTLEKLGFPMYAHVDKANFTVQRMVGLLGQILLPC 285 house mouse
Q9Z2Y0 206 VCIMGPEGTPVSWALMDHTGELRMAGTLPKYRHQNLIYHVAFHQVHTLEKLGFPMYLHVDKVNLTIQRMSAVLGHVPMPC 285 Norway rat
O77512 206 FCLLGPEGTPASWSLMDQTGEIRMGATLPEYRGHGLISHMLAVHTRALDQLGIPVYNHTDKANKIVQKVSHNLHHIAIPH 285 cattle
Q2KIR7 206 FCLLGTEGTPVSWSLMDQTGEMRMAGTLPEYRAQGLVTHAIYQQAQCLLKRGFPVYSHVDPKNQIMQKMSQSLNHVPMPS 285 cattle
Q5RFP0 287 SWNQWNCVP 295 Sumatran orangutan
Q5PQT3 287 AWNQWICVP 295 Norway rat
Q8WU03 282 GWHQWKCTP 290 human
Q969I3 288 EWHQWTCYP 296 human
Q9DCY0 286 TWNQWNCVP 294 house mouse
Q9Z2Y0 286 TWNQWNWVP 294 Norway rat
O77512 286 GWNQWNCEP 294 cattle
Q2KIR7 286 DWNQWNCEP 294 cattle
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap