6DJP


Conserved Protein Domain Family
Integrin_alpha2

?
pfam08441: Integrin_alpha2 
Integrin alpha
This domain is found in integrin alpha and integrin alpha precursors to the C-terminus of a number of pfam01839 repeats and to the N-terminus of the pfam00357 cytoplasmic region. This region is composed of three immunoglobulin-like domains.
Statistics
?
PSSM-Id: 400650
View PSSM: pfam08441
Aligned: 38 rows
Threshold Bit Score: 348.922
Threshold Setting Gi: 156406056
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6DJP_A        437 ARPVITV-NAGLEVYPSIl-NQDNKT--CSLPg--TALKVSC-FNVRFCLKADGKGV------LPRKLNFQVELLLDKL- 502 
XP_001641047  483 SRPIIDI-NTDVNITPNPf-NSRNKT--CSKTfkgKLIQTVC-IDIEICLSYSERRNrt---hDKLSIDLNIEADVEYTr 554  starlet sea a...
Q03600        495 SRPVISI-ETKHKMEKRMv-DIDKGVn-CPRG------AKTC-FPLDMVIYVDEETKrgaelvDFSSDVFMCNLEAIPF- 563  Caenorhabditi...
Q7QF51        468 ARPIINIrTYEEQQAGEPg-SIDPTRvgCPSD---PTANVTC-FSFRACSAVDDASLsegdvsADSSLQLRCTIQAET-- 540  Anopheles gam...
Q29JH5        370 ARPIINI-QTSYRSEELRniDPNQPG--CRAD---AFSNLTC-FTFEACCSIEPYDD------STKELSLMYSVEAETY- 435  Drosophila ps...
Q17KN9        418 ARPITNI-KTSVMIEELQ--NIDPTKhgCRAD---PTANATC-FSFKACCSIEPYEEsghsssSTQPLNLIYTIEAETY- 489  yellow fever ...
P13612        463 TRPVVIV-DASLSH-PESv-NRTKFD--CVEN----GWPSVC-IDLTLCFSYKGKEV-------PGYIVLFYNMSLDVN- 524  human
Q13797        459 ARPVITV-DVSIFL-PGSi-NITAPQ--CHDG----QQPVNC-LNVTTCFSFHGKHV-------PGEIGLNYVLMADVAk 521  human
Q24247        479 ARPIISI-QTSVQRKELH--NMDPNTpgCLDD---PASNLTC-FTFRACCSIEPYDE------KNKELRLAYSVEAETF- 544  fruit fly
CAG08300      486 ARPVVHI-GSTLQVTPNNi-DRDKIKeqCD-----MSLPSCSnFAARACFSYTAHPEs-----FSPKLILDYTFEADIKr 553  spotted green...
6DJP_A        503 -KQKGAIRRALFL-----------------YSRSPSHSKNMTISRGGLMQCEELIAYLRD--EseFRDKLTPITIFMEYR 562 
XP_001641047  555 nSRTSKQSRVVFSt---------------sEGPALNKTLTDALPHKPRKACFLEEVFLRE--N--VEDVYPDITFRINYK 615  starlet sea a...
Q03600        564 --RADTTARGFIE-----------------GSHSHNYSWPCGSNSHVQKRTYRQLIYL-PvqE--SKDWITPLKFRFTVS 621  Caenorhabditi...
Q7QF51        541 --FLNKFSRVYFGtgggpgadktpavpgaaATRTNILKRRFRLAVSGRPVCHDVTAYLKE--G--TRDIQNPIQFRISYT 614  Anopheles gam...
Q29JH5        436 -DHLKKFSRAFFDr---------------dNKRSNVISRVVKVRTDGRVACQMVTGYIKA--N--TRDIQTPISFRLKYT 495  Drosophila ps...
Q17KN9        490 -NNLKKFSRVYFGpd--------------tRNRSNTLRKHISVITDGRQECREEVVYIKD--N--TRDIQNPIRFRLNYT 550  yellow fever ...
P13612        525 -RKAESPPRFYFS-----------------SNGTSDVITGSIQVSSREANCRTHQAFMRK--D--VRDILTPIQIEAAYH 582  human
Q13797        522 -KEKGQMPRVYFVl----------------LGETMGQVTEKLQLTYMEETCRHYVAHVKR--R--VQDVISPIVFEAAYS 580  human
Q24247        545 -DHLKKFSRVFFFdr--------------eNKRTNVLSRVVRVHTNGRTECQAVTGYIKA--N--TRDIQTPVRFRLKYS 605  fruit fly
CAG08300      554 -KKARLPPRVDF---------------------LGVPRGRLELPGQKRKICTDIELRLLR--D--FKDWLHAIPISVTAS 607  spotted green...
6DJP_A        563 L--------------DYRTAADTTGLQ--PILNQf--TPANISRQAHIL-LD---------------------------- 595 
XP_001641047  616 Mhep--------svpPTAAPGTLSSLKdyAMLETk--KGSFASAMLKFQ-RDcvkcepnlqisdksdscsrvpvhvsltg 684  starlet sea a...
Q03600        622 Irnek-------kpvQPPQGSQLVDLKhyPVLNK---YGASYEFDVPFN-TL---------------------------- 662  Caenorhabditi...
Q7QF51        615 LdeeranggtgaggrRGRKERELPRLE--PILNR---TAAERTYTMPFQ-KD---------------------------- 660  Anopheles gam...
Q29JH5        496 Le------------ePPLADSALTRLN--PMLDQ---TQAHIDFEGTFQ-KD---------------------------- 529  Drosophila ps...
Q17KN9        551 Il------------dTTLPASALDTLD--PILDQ---TQADRTFEATFQ-KD---------------------------- 584  yellow fever ...
P13612        583 Lgph---------viSKRSTEEFPPLQ--PILQQk-kEKDIMKKTINFA-RF---------------------------- 621  human
Q13797        581 Lse----------hvTGEEERELPPLT--PVLRWkkgQKIAQKNQTVFE-RN---------------------------- 619  human
Q24247        606 Lv------------ePPLADSALVRLN--PILDQ---TQAHVDFEGTFQ-KD---------------------------- 639  fruit fly
CAG08300      608 L--------------GDSTQWTSERVT--PVLDLf--QPKYTVSEINITnRG---------------------------- 641  spotted green...
6DJP_A            --------------------------------------------------------------------------------     
XP_001641047  685 svlvlelfsstgtcqsnrkcscplelfsstgtcqsnrkcscplelfsssgtcqsnrkcscplelfsstgtcqsnrkcscp 764  starlet sea a...
Q03600            --------------------------------------------------------------------------------      Caenorhabditi...
Q7QF51            --------------------------------------------------------------------------------      Anopheles gam...
Q29JH5            --------------------------------------------------------------------------------      Drosophila ps...
Q17KN9            --------------------------------------------------------------------------------      yellow fever ...
P13612            --------------------------------------------------------------------------------      human
Q13797            --------------------------------------------------------------------------------      human
Q24247            --------------------------------------------------------------------------------      fruit fly
CAG08300          --------------------------------------------------------------------------------      spotted green...
6DJP_A        596 -----------------------------------------------CGEDNVCKPKLEV-SVDSDQKK----------- 616 
XP_001641047  765 lelfsssgtcqsnrkcscplelfsstgtcpsnrkcscplelfsstgtCQSNGKCSCPLELfSSTGTCQSngkcscpl--e 842  starlet sea a...
Q03600        663 -----------------------------------------------CGEDHTCQTDLSL-KAAFKDIPlt--------- 685  Caenorhabditi...
Q7QF51        661 -----------------------------------------------CGVDGLCQSALVI-QNATLVGLarsgga----- 687  Anopheles gam...
Q29JH5        530 -----------------------------------------------CGDDDLCESDLVI-RAEPNITAidn-------- 553  Drosophila ps...
Q17KN9        585 -----------------------------------------------CGHDGICQSKIDV-KAKLSLEQqvdg------- 609  yellow fever ...
P13612        622 -----------------------------------------------CAHEN-CSADLQV-SAKIGFLKphen------- 645  human
Q13797        620 -----------------------------------------------CRSED-CAADLQL-QGKLLLSSmdek------- 643  human
Q24247        640 -----------------------------------------------CGDDDLCESNLII-RVEPNITEssgn------- 664  fruit fly
CAG08300      642 -----------------------------------------------CGSDNICQSNLSL-EYRFCSRQmensksvfrsl 673  spotted green...
6DJP_A        617 ------IYIg-DD--NPLTLIVKAQN-QGEGAYEAELIVSI-PLQADFIGVVrn----------------nEALARlSCA 669 
XP_001641047  843 lfssyyITLavGE--RDYVVDVTISN-TGESAYNTELLVTI-PEGVAQSRVLdas--------------dtDKEAFsIGH 904  starlet sea a...
Q03600        686 ----snGYVsnVGekDYLDLTFTVEN-KKEKAYQANFYLEYnEEELELPQVQ---------------------------G 733  Caenorhabditi...
Q7QF51        688 aggeyqLVLg-LD--RTLTLALTVQN-RADSAYETHLYVRH-DASLTYAGSK----------------------GSsVCG 740  Anopheles gam...
Q29JH5        554 ---kytLIL--DE--TELEVGISVSN-LADSAYEAQLFISH-QAGVSYVATK-------------------KPTNA-TCN 604  Drosophila ps...
Q17KN9        610 ---sysLVLg-RD--RGILLNVSVSN-QADSAYETHLYVKH-DPSISYSGTKvyseckrnrkpfiynnapfHFQSLhTCT 681  yellow fever ...
P13612        646 ---ktyLAVg-SM--KTLMLNVSLFN-AGDDAYETTLHVKL-PVGLYFIKILe------------------LEEKQiNCE 699  human
Q13797        644 ---tlyLALg-AV--KNISLNISISN-LGDDAYDANVSFNV-SRELFFINMWq------------------KEEMGiSCE 697  human
Q24247        665 ---eytLIL--DE--TELEVRINVSN-LADSAYEAQLFIAH-QAGVSYVATK-------------------KPTNA-TCN 715  fruit fly
CAG08300      674 srkdgvAVItpTE--EDIALEMTVTNrGGDDAHQTRSIISL-PDTLHYSSVVt-----------------tASEPKvDCT 733  spotted green...
6DJP_A        670 FKTENqt----rQVVCDLGNPMKA--GTQLLAGLRFSVHQQSE---------MDTSVKFDLQIQSSNLFDK---VSPVvs 731 
XP_001641047  905 QAVSDktennstRLRIPIGNPMKT--RTMKRVQVFLNTGSFSK---------SQDFLPILLEVTSSNKEQPeqlKDNLie 973  starlet sea a...
Q03600        734 SKRMIaetigknIVHLPLGNPMNGasKHQFTIQFKLTRGRTEG---------IGKALKFMAHVNSTSQETEeelKDNKwe 804  Caenorhabditi...
Q7QF51        741 AHNAT-------MVDCSIGNPLKR--NGEVQLSLRFDARSLEEygsskgpngLSQHVALAVFVNTTSQDTG---NRTRaq 808  Anopheles gam...
Q29JH5        605 SFNTT-------LVVCSLGNPMLR--GTTTFVTIRFQPKSLEP---------NENSMLFHIFANTTSKLVGg--EPPErn 664  Drosophila ps...
Q17KN9        682 QFNST-------LVDCSLGNPMRR--GTEAKLSLRFDPQRVDD---------LVSKLTFQVFVNTTSALLEgtkSEAS-- 741  yellow fever ...
P13612        700 VTDNSgv----vQLDCSIGYIYVDh-LSRIDISFLLDVSSLSR---------AEEDLSITVHATCENEEEMdnlKHSRvt 765  human
Q13797        698 LLESD-------FLKCSVGFPFMRs-KSKYEFSVIFDTSHLSG---------EEEVLSFIVTAQSGNTERSeslHDNTlv 760  human
Q24247        716 SYNTT-------LVACSLGNPMLR--DTTTFVTIRFQPKGLEP---------SEKIMLFHIFANTTSKLVGperPERD-- 775  fruit fly
CAG08300      734 ANDKGt------LIDCELGNPIEK--DAEVTFYVMLTTSGISL---------STKAVNISLQLQTTSTQV-----LKPve 791  spotted green...
6DJP_A        732 HKVDLAVLAAVEIRGVSSPDHVF--------------LPIPNWEHKEnpeTEEDVGPVVQHIYELRNNGPS--SFSKAML 795 
XP_001641047  974 LNVTIVSQADLELSGSFKQEQVSy-------------GGEVKGESAMr--VEDEIGNEVRHTYIAQNKGPD--FVPEAEV 1036 starlet sea a...
Q03600        805 AEVQIIKKAELEIYGISDPDRVF---------------FGGKARAESeleLEEDIGTMVRHNYTIINHGPW--TVRNVEA 867  Caenorhabditi...
Q7QF51        809 LNLRIQRAVKLSISGKALPEQVFyg----------ggGEQIMGESAIh--SLDEIGMPVQHKYQIYNDGPW--RAPMVRL 874  Anopheles gam...
Q29JH5        665 LSVSVVRQAKLHFRGWAMPEQSFy-------------SGASQVTDNSp-mEMVDVGSQVNHSFTIFNDGPS--TAPKVRM 728  Drosophila ps...
Q17KN9        742 IVANVIKRAKISISGAAHPEQAFy-------------GGDVKGESAMe--TVEDIGTAVQHIYLIYNDGPW--RAPKVQV 804  yellow fever ...
P13612        766 VAIPLKYEVKLTVHGFVNPTSFV------------------YGSNDEn-ePETCMVEKMNLTFHVINTGNS--MAPNVSV 824  human
Q13797        761 LMVPLMHEVDTSITGIMSPTSFVy-------------GESVDAANFIqldDLECHFQPINITLQVYNTGPS--TLPGSSV 825  human
Q24247        776 LRVNVVRRAKLNFRGWAIPEQSFysgssvansvantaATDIEGHGPM---GMDDVGSQVHHMFTIFNEGPS--TAPKVQM 850  fruit fly
CAG08300      792 ASAKVFFELKLQLYGVARPSQVSf-------------GRSLEGKSTIn--SVEEIGALVQYEFRITNLGRSlkYFTNASL 856  spotted green...
6DJP_A        796 HLQWPYKYNNNT--------LLYILHYd--------IDGPMN-CT----------------SDMEINPLRI--------- 833 
XP_001641047 1037 VIQWPFEATNGKh-------LLYLMDVe--------ISGNAE-CTf---------------APDQPNLLGLivkpks--- 1082 starlet sea a...
Q03600        868 HISWPYQLRSRFgrg---knALYLLDVptitteftdGTSEVRkCFik-------------qQYEYVNPAEIk-------- 923  Caenorhabditi...
Q7QF51        875 EIDWPLQVANNKpqg---kwLLYLDALpvldmsgimGDGRST-CDvlrkdepdgavvaggdSVPLVNPLGL--------- 941  Anopheles gam...
Q29JH5        729 IIHWPWSLYSDPerghmdlyLLYLEQMpt------vEIGVGE-CHv---------------APEYVNPLKLasgsqesas 786  Drosophila ps...
Q17KN9        805 NIQWPHQVANDKpqg---kwLLYLTDTpt-----veATNGGD-CVv--------------dPHSAINPLGLkkssv---- 857  yellow fever ...
P13612        825 EIMVPNSFSPQTd------kLFNILDVq---------TTTGE-CH----------------FENYQRVCAL--------- 863  human
Q13797        826 SISFPNRLSSGGa------eMFHVQEMv-------vGQEKGN-CS----------------FQKNPTPCII--------- 866  human
Q24247        851 VIHWPYSLYSDPqsgrpvqyLLYLEQVpt------vEVSQGE-CHv---------------AKEYVNPLNLasgsrenpa 908  fruit fly
CAG08300      857 NIFWPKENSLGKw-------LLYLTQTsn------tGVQSVP-CS----------------PVKEINPLKN--------- 897  spotted green...
6DJP_A        834 -------------------KISSLQTTEKNDTvagqgERDHLITKRDLALSEG----D---------------------- 868 
XP_001641047 1083 -------------sparnvTSRQSSSESTRTT-----RVRRAVEEETSIKTKRatadErg-------------------- 1124 starlet sea a...
Q03600        924 -------------------LNTKYSTQETAPH-----RVEHRMKREIDEDEEEqsddLgaveenipwfstanfwnlfaik 979  Caenorhabditi...
Q7QF51        942 -----------------------PSRTGPSAP-----PSPFTALRSANYTRAGrvrrDramvlr---------------- 977  Anopheles gam...
Q29JH5        787 gf------lgapatlmmvhGRSQLNKNQTHST-----HSTHSRQQRSTLERVTrlerLiyepeaagmg-----------s 844  Drosophila ps...
Q17KN9        858 ---------------lgqlMQMERYTQRAYNK-----SLTFTSEKSERISFAKqtssAsentlnrvrrdrsmiiraerlt 917  yellow fever ...
P13612        864 -------------------EQQKSAMQTLKGI-----VRFLSKTDKRLLYCIKad------------------------- 894  human
Q13797        867 ---------------------PQEQENIFHTI-----FAFFTKSGRKVLDCEKpg------------------------- 895  human
Q24247        909 ylsapaqmrmfpsqsrhsfNKSLIHSQRSYYS-----SSHRDDHSDDTQSNRNrvrrSflervtrlerlmyd---pessn 980  fruit fly
CAG08300      898 -------------------V-KGLSRKKREAE-----LEALTSGDFSFLPTKRky------------------------- 927  spotted green...
6DJP_A        869 --------IHTLGCGVA--QCLKIVC 884 
XP_001641047 1125 -------sSVKLDCETGtaRCTPIRC 1143 starlet sea anemone
Q03600        980 ggdgrpreVKHLSCQDNtaNCFTVIC 1005 Caenorhabditis elegans
Q7QF51        978 --pqagdgAVQMDCASQtaKCVRIVC 1001 Anopheles gambiae str. PEST
Q29JH5        845 sgsgkkqdIVELDCNKGtaRCIRIEC 870  Drosophila pseudoobscura
Q17KN9        918 dkdgkqtdIVHMDCKRNtaKCISIVC 943  yellow fever mosquito
P13612        895 ------------------pHCLNFLC 902  human
Q13797        896 ------------------iSCLTAHC 903  human
Q24247        981 aangkkqdIVELDCNKGatNCVRIEC 1006 fruit fly
CAG08300      928 ---------ktLTCADGl-RCVEICC 943  spotted green pufferfish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap