Conserved Protein Domain Family
Glyco_transf_8C

?
pfam08437: Glyco_transf_8C 
Glycosyl transferase family 8 C-terminal
This domain is found at the C-terminus of the pfam01501 domain in bacterial glucosyltransferase and galactosyltransferase proteins.
Statistics
?
PSSM-Id: 400647
View PSSM: pfam08437
Aligned: 18 rows
Threshold Bit Score: 54.1979
Threshold Setting Gi: 81646599
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_014005031    265 ASTALFVKYQALSPWADLALDPaPRNYKEMRMYSRFLMKRGQVLDSFRWYMKYLS 319 Collimonas fungivorans
P19816          279 PVSQYFLQAKSNSPWSHCALLN-PVTSHQLRYAAKHMFNQKHYTSGINYYIAYFK 332 Salmonella enterica subsp. enterica s...
Q329M8          280 PSAQPFIKAKETSPWKNEPLMR-PANSNYARYCAKHNFKQNKPINGIMNYIYYFY 333 Shigella dysenteriae Sd197
WP_002442588    280 ASATPFLVAREHSPWKDTPLMS-PGNANYARYCAKHNFKQGKNIAGIINYIFYFY 333 Shimwellia blattae
Q6DAU4          279 ACTKYFLKAKENSPWKNEPLLD-AVTASNMRYCAKHQFHNGDIIRGTLSILSYLY 332 Pectobacterium atrosepticum
1_pfamImport      2 PSTIFFQKAYLASEWNDVPLLK-PRTSLQWKKISKHEFRKYHLFSGILARLKYII 55 
CDD78930        271 PVVKEYAAIQKSSPWKDVPLVP-PKGTKNLHQAARSARMNGQYGAMIGWYLKYIG 324 Dialister sp. CAG:357
jgi:Rahaq2_4465 272 eladIYDQYYAQSPWHAVPHDV-PVSYKEMKRYAQALWYKGRYLTSLRWMSKYMN 325 Rahnella aquatilis CIP 78.65 = ATCC 3...
Q329N1          279 PCQNYFNEAYQASCWNDVAFIP-ATNEKQYQVKSRHLKRNGNIASSFYYFILYYS 332 Shigella dysenteriae Sd197
WP_012135766    277 PVSKYFIEAYKKSAWAEKSLLN-ANTAKLYKRKSRHERIQRKYIRSIFSHIMYIK 330 Citrobacter
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap