Conserved Protein Domain Family
ICE2

?
pfam08426: ICE2 
ICE2
ICE2 is a fungal ER protein which has been shown to play an important role in forming/maintaining the cortical ER. It has also bee identified as a protein which is necessary for nuclear inner membrane targeting.
Statistics
?
PSSM-Id: 400638
View PSSM: pfam08426
Aligned: 57 rows
Threshold Bit Score: 318.768
Threshold Setting Gi: 634347926
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CCE62496      61 AVLVAFYLLNIVVTIPISFKIGGIYCGLSFTGTLFGLYFISTSVTIITKRLthnTTLrLLASSLFYIQNFIISSLLQIYL 140 Tetrapisispora ...
EEQ36336       6 pLLSAYYLALVVLTIPLAFDVGGIECGLAYSLAMSALYFVLTTLRLASRRS---PLA-RVATVFYYSQHVLMPSLLMHFL 81  Clavispora lusi...
XP_004201901  14 AVLSVLYLTLIVLSIPLAFDVGGVQCGLAFSLTVLLLYSILTTIRLIFRRR---KYF-RWISIVYYCQHIFIPSLLTLFL 89  Pichia farinosa...
Q6BYC3        14 AVLSTVYLALIILSIPLAFDVGGITCGLAFSFTTFTLYFVLTTIRIVTRKS---RYF-GWVSLLYYLQHIIIPSLLTLFL 89  Debaryomyces ha...
XP_001486301  12 ALFSFAYLALVILTVPLAFDVGGIPCGLSYSFTLFSIYFVLTTVRMITKKS---RWF-RWVSLLYYTQHFVIPSLLTFFL 87  Meyerozyma guil...
XP_001385893  14 AFLGTLYLVLVILTIPLAFDVGGVTCGLAFSLTTFLLYFSLMTIRLVTRRS---KYF-RWISILYYSQHFVIPSLLTFFL 89  Scheffersomyces...
XP_002545902  13 GIFSTVYLGLIILTIPLAFDVGGVYCGLAFSLTTLVTYFILTTIRIAVRRT---RYF-QWISIIYYCQHFFIPSLLTYFL 88  Candida tropica...
XP_001525496  17 ALFASLYLALIILTIPLAFDVGGVTCGLAFSFTTLVIYFVLTTIRILSRRT---KYF-KWISIVYYSQHFFIPSLLTYFL 92  Lodderomyces el...
CCE42665      14 ALFASLYLVWVILTIPLAFDVGGVNCGLAFSLTLLVTYFILTTIQLLARRT---RYF-KWISLVYYGQHFLIPSLLTYFL 89  Candida parapsi...
CAY69725      15 VLLATLYLVLIVLTTPLSFEIGGLECGLSYSISILLLYFVLATIRVLKCNR-------ILSSFLYYLQHLLLPSLLFTFL 87  Komagataella ph...
CCE62496     141 RGFNNKdlitaLtflddyyyNek-----ngTNTKYQilfiikdyfvnimnlilfrednglnkmlqlalksegnsvpdpqk 215 Tetrapisispora ...
EEQ36336      82 QRYPRSgalppAla------------------------------------------------------------------ 95  Clavispora lusi...
XP_004201901  90 SYY-----------------SskhtsdsmaSRPIEM-------------------------------------------- 108 Pichia farinosa...
Q6BYC3        90 SYY-----------------RtnqpttltaYHPHEI-------------------------------------------- 108 Debaryomyces ha...
XP_001486301  88 SYYstkq-------------------psprLNPVDV-------------------------------------------- 104 Meyerozyma guil...
XP_001385893  90 SYY-----------------RtenkvvykyINPVDI-------------------------------------------- 108 Scheffersomyces...
XP_002545902  89 SYY-----------------SngvtpneskYNPIMI-------------------------------------------- 107 Candida tropica...
XP_001525496  93 SYYrqnhq------------------iesgWSLLSV-------------------------------------------- 110 Lodderomyces el...
CCE42665      90 SYYsndpk------------------ieskLNPVLI-------------------------------------------- 107 Candida parapsi...
CAY69725      88 SYFkenhr-----------------------------------------------------------------------l 96  Komagataella ph...
CCE62496     216 lnswILFFYYYYIFIKPWKFLLINSTPFFTLLEGFFTILGIQTIGETNIWLKQQKhSSFWVILSLLSSGGVITATLYYLN 295 Tetrapisispora ...
EEQ36336      96 ----------------vWRYLLVHSTSVFTVAEGFCSLLLIQAASQTLGWLTAHR-SDSWLFVSLIGSGCTITGALYFLY 158 Clavispora lusi...
XP_004201901 109 -----------------WRFIMLHSTPIFTILEGFCSLLLIQAIGQTVEWLTTHK-SDSWLIVSLIGSGSTITAALYFLY 170 Pichia farinosa...
Q6BYC3       109 -----------------WRYFIVNSTPIFTILEGFCSLLLIQAIGETVNWLTVYK-SDSWLIVSLMASGSTITAALYFLY 170 Debaryomyces ha...
XP_001486301 105 -----------------WKFCVVNSTPIITIMEGFCSLLLIQAVGQTLNWFTIHR-SDNWLIVSLVGSGLTTTTACYFLY 166 Meyerozyma guil...
XP_001385893 109 -----------------WRFLLINATPVFTILEGFCSLLLIQAIGQTINWLTIYK-SDTWLIISLVGSGSTITAAFYFLY 170 Scheffersomyces...
XP_002545902 108 -----------------WKLILINSTPLFTILEGFCSLLLIQAVGQTVNWLTLYK-SDSWLILSLIGSGSVITASFYFLY 169 Candida tropica...
XP_001525496 111 -----------------WKTLLVNATPVFTILEGFCSLLLIQAIGQTVNWLTNYK-SDSWLIISLVSSALVDTAAFYFLY 172 Lodderomyces el...
CCE42665     108 -----------------WKFLLINATPIITILEGFCSLLLIQAIGQTVNWLTMYK-SDSWLIISLIGSAVVDTGAFYCLY 169 Candida parapsi...
CAY69725      97 ltndILQNIWWNYIISSWKFFLVNSTPLFIILEGFCSLLLIQAVGQISTWLVRNK-SDTLSILNLMLSSIIISSSLYFVL 175 Komagataella ph...
CCE62496     296 RIYVTPfwDLTVSTASMLGFTLSIVGGLGVFGIVSKNGSAIESSLFFAYIVRCIYEMSPELAISATDef-lEGFNEVWQM 374 Tetrapisispora ...
EEQ36336     159 RIYIFPl-ALDLGNASLLGSFLTVTAGLGLYGIVSGKGSMIESSLLFAYIVRCIYETFPSLSEDATQav-aHVFAQTTAN 236 Clavispora lusi...
XP_004201901 171 RIYVFPf-TIDLLSASLLGSSLTLTAGIGLFGIVSGKGSIIESSLLFAYIVRCIYETFPILSQDASKal-aSLFTQTTYN 248 Pichia farinosa...
Q6BYC3       171 RIYVFPf-TIDMISASLLGSLLTLTAGLGLFGIVSGKGSMIESALLFAYIVRCIYETFPILSEDASKtl-tSIFTQTTFN 248 Debaryomyces ha...
XP_001486301 167 RIYTLNf-TIDMVNASLLGSSLTLTIGIGAFGIVSGRGSMIESSLLLAYIVRCIYETFPDLSENASEal-aSLFAQTTTT 244 Meyerozyma guil...
XP_001385893 171 RIYVFPf-TIDIVSASLLGSLLTLTVGIGGYGIVSGKGSMIESSLLFAYVVRCIYETFPILSEGATRtl-tSLFTQATNN 248 Scheffersomyces...
XP_002545902 170 RIYVLPf-AIDMFSASLLGSLLTTTLGLGLFGIVSGKGSMIESSLLFAYIVKCIYETFPILSEGASQal-tNLFNLTTQN 247 Candida tropica...
XP_001525496 173 RIYVFPf-TIDILSASLLGSLLTLTIGLGLFGIVSGKGSMIESSLLFAYIVRCIYETFPILSEDASKal-aHLLMLTTQN 250 Lodderomyces el...
CCE42665     170 RIYVLPi-TIDILESSHLGSLLTLTFGLCLYGIVSGKGSMIESSLLFAYIVRCIYETFPSLAEGASQal-aNLLTSASQN 247 Candida parapsi...
CAY69725     176 RIYVST--TIGSLSASLLGSILTLTTILSIYGIMKNKASPLESSLLISYIVKCIYDLFPELSQHNINnlikFIMKEFTRI 253 Komagataella ph...
CCE62496     375 NQNRITVadnvltyckkyimdafssfssiehhlfpktielgISKNLIvkQFWVFLKNFTInVPSSINDLIQItAQMAVDS 454 Tetrapisispora ...
EEQ36336     237 LRLELAH----------------------------------LPRPVAd-TLSAFLPSLAAnLPHSFKAVWDV-FFSAVHK 280 Clavispora lusi...
XP_004201901 249 LKNEIPK----------------------------------LPPQITn-TVMSLFPFLAEnLPGSFKTIWEF-LITAILK 292 Pichia farinosa...
Q6BYC3       249 LRNEIPK----------------------------------LPPQITn-TVLQLLPFLASnLPGSFKAIWEF-LIMSIHK 292 Debaryomyces ha...
XP_001486301 245 LKNQIPL----------------------------------LPPTIId-TVLNAVPFLASnLPMTMKTIWHF-LVISLQK 288 Meyerozyma guil...
XP_001385893 249 LRNEIPK----------------------------------LPHQIIn-PISQLIPFLASnLPGSFKTIWEF-LLMAIQK 292 Scheffersomyces...
XP_002545902 248 LKKEIPK----------------------------------IPPSILn-PISEVVPFLAStLPSSFKGVWKF-LIMAIQT 291 Candida tropica...
XP_001525496 251 VRKEIPK----------------------------------IAPSILn-PISELVPFLTStMPSSFKGVWEF-LVMAIQN 294 Lodderomyces el...
CCE42665     248 VRNEIPK----------------------------------IPPSIMn-PISELVPFLTKtFPSSLKGVWEY-LVEALQK 291 Candida parapsi...
CAY69725     254 NEHSMMInknfitslsnayhnyny---------sydltkleqyykivkyFSNKTFEFLTEsFPQSFESIWEF-LKLSSSN 323 Komagataella ph...
CCE62496     455 ISPAIIINLSFRLMIFYSATRIIPAIQRRTKP------D----------------------------------------- 487 Tetrapisispora ...
EEQ36336     281 LTLPLLVNLAYRIGVFYAATKIIPSLYHTLPHs----pArtpqtsssslaslgrddkqsendkqndsend-------nqn 349 Clavispora lusi...
XP_004201901 293 LPLPLVLNLAYRIGVFYAATKIIPSIYHGAPYls--tpPrtpshirsrqsssshlsgdvnyfplanaski--------ek 362 Pichia farinosa...
Q6BYC3       293 LPLPLLLNLAYRIGVFYAATKIIPSLYHDASYpfn-tpPrtpsqnrsprpsstnipglsqsvsnsqtppnshhnrthets 371 Debaryomyces ha...
XP_001486301 289 LTIPLLLSLAYRLSVFYAATKIIPSLYYGSMYptf-spPrtpasksrqssssslf------------------------- 342 Meyerozyma guil...
XP_001385893 293 LTLPLLLNLAYRIGVFYAATKIIPLLYQNAAYpn--tpPrtppqatrsrqasnkslselassipttedt---------nl 361 Scheffersomyces...
XP_002545902 292 LTLPLLLNLAYRIGVFYAATKIIPSLYQSISYpsv-tpPktpqtssrqpssvslshltdpkspts--------------- 355 Candida tropica...
XP_001525496 295 LTLPLLLNLAYRIGVFYAATKIIPSLYKS-SYpnitspPkspkigsrhssstalrelanvdpsrpesattits--knsks 371 Lodderomyces el...
CCE42665     292 LPLSLLLNLAYRIGVFYAATKIIPSLYKSVSYpsttslQqrsrqpsstrlssless------------------------ 347 Candida parapsi...
CAY69725     324 LTLPIILSLAYRIGVFFAATKIIPILQPNNRNfk---------------------------------------------- 357 Komagataella ph...
CCE62496     488 ----------------------------AHDLTG------FMSAVYWFSPCMLIAMYTHLILQFSGELKKNiclwncenw 533 Tetrapisispora ...
EEQ36336     350 dkqneqneqneqneqneqnengsrrtrgHRPDRQmvrrpaVIRLLYAYSPCIVIAVYTHLMLSYRGELGSElmlwgwwa- 428 Clavispora lusi...
XP_004201901 363 edtnddmpsemqlkqeslvinnakasrrREPPST------ILKLIYAYSPCIIIAVYTHLMMSYNGELGTEltiwgwwn- 435 Pichia farinosa...
Q6BYC3       372 seevidtteiqplsrsqssfarnsfgkkREPRST------IIRLIYSYSPCIVIAVYTHLMMLYKGELGTElkiwgwws- 444 Debaryomyces ha...
XP_001486301 343 -------------qestiskppqkkirtRQPKAT------ILKLIYAYSPCFIIFAYTHLMMQYSGQLGTElklwgfwe- 402 Meyerozyma guil...
XP_001385893 362 eesisfkevtkpitplrdrksfrlkpphHQPPSA------IISLIYAYSPCIVIAVYTHLMLSYSGELGTElkiwgffs- 434 Scheffersomyces...
XP_002545902 356 ---ssvssissskpnlrskksfrlkpphHQPPSV------IIRLIYAYAPILIIAVYTHLMLSYNGELGTElqlwpiwns 426 Candida tropica...
XP_001525496 372 dltnsyntngvnripltsrksfhlkpphHQPPSA------IIRLIYAYSPCLIIAVYTHLMLSYTGELGTElqiwpiwgl 445 Lodderomyces el...
CCE42665     348 -----------ervplksrksfhlkpphHQPPSA------FIRLIYAYSPCLVIAVYTHLMLSYIGELGVElqvwpiyg- 409 Candida parapsi...
CAY69725     358 --------------------------------------nyYLKLIYLYSPCIIIAVYTNLMLQYNDELDKEndswnwvii 399 Komagataella ph...
CCE62496     534 lssss------dvkstnlgdnsiiVDSWSFWNWCNIFWTIIIYASELIG 576 Tetrapisispora phaffii CBS 4417
EEQ36336     429 ----------------daddmvivVHPWQFWNWINMGTTLLLYMAELSG 461 Clavispora lusitaniae ATCC 42720
XP_004201901 436 ----------------kdsnfhfvVHPWQFWNWVNMGTTLLLYTAELLG 468 Pichia farinosa CBS 7064
Q6BYC3       445 ----------------pnsdiqviVHPWQFWNWVNMGTTLLLYTAELLG 477 Debaryomyces hansenii
XP_001486301 403 -----------------ssdftviVHPWQFWNWINMATTLLLYTAELLG 434 Meyerozyma guilliermondii ATCC 6260
XP_001385893 435 -----------------ssavsivVHPWQFWNWVNMATTILLYAAELSG 466 Scheffersomyces stipitis CBS 6054
XP_002545902 427 tt------------snsqdnfqiiVHPWQFWNWINMGTTLILYAAELSS 463 Candida tropicalis MYA-3404
XP_001525496 446 ssssypfssssssssssssssaivVHPWKFWNWINMGTTLILYVAELMS 494 Lodderomyces elongisporus NRRL YB-4239
CCE42665     410 -----------------nagtkivVHPWKFWNWVNMATTLILYVAEL-S 440 Candida parapsilosis
CAY69725     400 klsnfgq--ksglfnyepvvlkddVHSWQFWNWINIFLVLSLYFIELQT 446 Komagataella phaffii GS115
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap