1SZP


Conserved Protein Domain Family
Rad51

?
pfam08423: Rad51 
Click on image for an interactive view with Cn3D
Rad51
Rad51 is a DNA repair and recombination protein and is a homolog of the bacterial ATPase RecA protein.
Statistics
?
PSSM-Id: 400636
View PSSM: pfam08423
Aligned: 22 rows
Threshold Bit Score: 330.405
Threshold Setting Gi: 20178063
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1SZP_D        63 MGFVTAADFHMRRSELICLTTGSKNLDTLL-GGGVETGSITELFGEFRTGKSQLCHTLAVTCQIPLDIGGGEGKCLYIDT 141 baker's yeast
Q95Q25       138 MGFTTGAEVHVKRSQLVQIRTGSASLDRLL-GGGIETGSITEVYGEYRTGKTQLCHSLAVLCQLPIDMGGGEGKCMYIDT 216 Caenorhabditis ...
XP_001709425 140 PGFMSGVVALERRQRIRRISTGCSDLDALL-GGGIESMAITEVFGEFRSGKTQLCHTIAVTAQLD------GSRVAYLDT 212 Giardia lamblia...
Q6CKB7        73 IGFIPATLQWQIRQAVMSISTGSKQFDSVL-GGGIMTMSITEVFGEFRCGKTQLSHTLCVTAQLPKELNGPEGKVAYIDT 151 Kluyveromyces l...
Q5ARI8        80 SGFITAMELSHQRKRVVRISTGSKQFDSIL-GGGFQSMSISEVFGEFRCGKTQLSHTMSVVAQLPKDMGGAEGKVAYIDT 158 Aspergillus nid...
O61128       108 VGFITGSSCLQQRSTLLRISTGSTALDQLLgGGGIESRSITEAFGEFRTGKTQIGHTLCVTCQLPLEMGGGNGKAVYVDT 187 Leishmania major
Q5CYN2        87 SSFQSGSEVMSRRQNILRITTGSEQFDKML-MGGFESMCITEIFGENRCGKTQICHTLCVAAQLPLEMNGGNGKVCFIDT 165 Cryptosporidium...
Q7GBF7        90 QGFMTGSDLLIKRKSVVRITTGSQALDELL-GGGIETLCITEAFGEFRSGKTQLAHTLCVSTQLPIHMHGGNGKVAYIDT 168 Japanese rice
Q9XED7        85 LGFTSASQLHAQRLEIIQLTTGSRELDQIL-DGGIETGSITEMYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKALYIDA 163 Zea mays
Q6Q242        87 MGFTTAAAVAEQRKEVISITTGCKELDTIL-EGGIETGSITEIYGEYRCGKTQLCHTLCVTCQLPVEMGGGEGKAMYIDT 165 Chlamydomonas r...
1SZP_D       142 EGTFRPVRLVSIAQRFGLDPDDALNNVAYARAYNADHQLRLLDAAAQMMSESRFSLIVVDSVMALYRTDFSGRGELSARQ 221 baker's yeast
Q95Q25       217 NATFRPERIIAIAQRYNMDSAHVLENIAVARAYNSEHLMALIIRAGAMMSESRYAVVIVDCATAHFRNEYTGRGDLAERQ 296 Caenorhabditis ...
XP_001709425 213 EGTFRPEKIGPIAERYKLDPTTTLSRIAYARAYTHEQQIELLAAAAEQMSEKKFALLIIDSLTALFRVDFTGRGELADRQ 292 Giardia lamblia...
Q6CKB7       152 EGTFRPERIKQIAQGYDLDPEVCLENISYARALNSEHQMELLEQLGEELSSGEYRLLIVDSIMANFRVDYSGRGELNERQ 231 Kluyveromyces l...
Q5ARI8       159 EGTFRPERIGQIAERFGVDPDSAKENIAYARALNSEHQLELLNTLSKEFVGGEYRLLIIDSIMNCFRVDFCGRGELADRQ 238 Aspergillus nid...
O61128       188 EGTFRPERIRPIAERFGMDSNSVLDNILVARAYTHEHQAHLLSMVAAKMAEDQFSLLVVDSITALFRVDFSGRGELAERQ 267 Leishmania major
Q5CYN2       166 EGTFRPERIVKIAERFGVQGDVALDNIMYARAYTHEHLNQLISAAAGKMIEEKFALLIVDSIIALFRTEFSGRGELAERQ 245 Cryptosporidium...
Q7GBF7       169 EGTFRPERIVPIAERFGMDANAVLDNIIYARAYTYEHQYNLLLGLAAKMAEEPFRLLIVDSVIALFRVDFSGRGELAERQ 248 Japanese rice
Q9XED7       164 EGTFRPQRILQIADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMVVDSATALYRTDFSGRGELSARQ 243 Zea mays
Q6Q242       166 EGTFRPQRLSQIAERYGLAPEDVLNNVAYARAHNTEHQMRLLQEAAGMMADSRFSLVVVDSATALYRTEFNGRGELSIRQ 245 Chlamydomonas r...
1SZP_D       222 MHLAKFMRALQRLADQFGVAVVVTNQVVAQVDG-GMAFNPDPKKPTGGNIMAHSSTTRLGFKKGKGCQRLCKVVDSPCLP 300 baker's yeast
Q95Q25       297 MKLSAFLKCLAKLADEYGVAVIITNQVVAQVDGgASMFQADAKKPIGGHIIAHMSTTRLYLRKGKGENRVAKMVQSPNLP 376 Caenorhabditis ...
XP_001709425 293 QKLGQHLASLAKLADEFNIAIFVTNQVMAQVDG-AAMFTADPKKPIGGHILAHASTTRLYLRKGRGNNRVAKIYDSPSLP 371 Giardia lamblia...
Q6CKB7       232 QKLNQHLSRLNRIAEENNIAVFMTNQVQSDPGAsALFASADGRKPVGGHVLAHASATRILLRKGRGDERVAKLQDSPDMP 311 Kluyveromyces l...
Q5ARI8       239 QKLNQFLMKLAHMAEEFNVCVLMTNQVQSDPGAsALFSGADGRKPVGGHVLAHASTTRVLLRKGRGEERVAKIQDSPDCP 318 Aspergillus nid...
O61128       268 QKLAKMLSQLIKIAEEFNIAVYITNQVVSDPGG-ASMFVADPKKPVGGHILAHASTTRLSLRKGRGDQRVCKIFDSPSLP 346 Leishmania major
Q5CYN2       246 QILNKTLSKLNKLADQFNIAIVMTNHVMADPAG-GMSFMPNVAKPVGGHVIGHASHVRLSLRKGKGEQRVCKVYGSPHLP 324 Cryptosporidium...
Q7GBF7       249 QKLAQMLSRLTKIAEEFNVAVYITNQVIADPGG--GMFITDPKKPAGGHVLAHAATIRLMLRKGKGEQRVCKIFDAPNLP 326 Japanese rice
Q9XED7       244 MHLAKFLRSLQKLADEFGVAVVITNQVVAQVDG-AAMFAGPQIKPIGGNIMAHASTTRLFLRKGRGEERICKVISSPCLA 322 Zea mays
Q6Q242       246 ILLGRFLRALQNIADEYGVAVVVTNQVVANPDGaGAMFAGPQTKPIGGNIMAHATTTRLSVRKGRGENRVVKIIASPSLP 325 Chlamydomonas r...
1SZP_D       301 EAECVFAIYEDGVGDP 316 baker's yeast
Q95Q25       377 EAEATYSITNHGIEDA 392 Caenorhabditis elegans
XP_001709425 372 EAEATFAVGEQGVCDA 387 Giardia lamblia ATCC 50803
Q6CKB7       312 EKECVYVIGERGIMDS 327 Kluyveromyces lactis
Q5ARI8       319 EREATYLITNGGIDDP 334 Aspergillus nidulans
O61128       347 ELECVYSISEQGIIDA 362 Leishmania major
Q5CYN2       325 ESECVIQLSDGGIIDP 340 Cryptosporidium parvum
Q7GBF7       327 EGEAVFQVTSGGIMDA 342 Japanese rice
Q9XED7       323 EAEARFQISSEGVTDV 338 Zea mays
Q6Q242       326 EREANFAIGQEGVTDA 341 Chlamydomonas reinhardtii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap