6UQF


Conserved Protein Domain Family
Ion_trans_N

?
pfam08412: Ion_trans_N 
Ion transport protein N-terminal
This metazoan domain is found to the N-terminus of pfam00520 in voltage- and cyclic nucleotide-gated K/Na ion channels.
Statistics
?
PSSM-Id: 400630
View PSSM: pfam08412
Aligned: 18 rows
Threshold Bit Score: 66.9469
Threshold Setting Gi: 942155348
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6UQF_A         98 FTSMLQPGVNKFSLRMFGSQKAVEKEQERVKTAGFWIIHPYSD 140 
CDS42820      473 FLMFFQPSDNKLAKKLFGTKVALNKERSRQRKQGKWIIHPASN 515  Echinococcus multilocularis
XP_001626416    5 LKSWLKPMDNKMNMKVFGSKRAMKDEQLRYSRAG-WVIHPTSI 46   starlet sea anemone
XP_001865076   37 LQAWFQPTDNRLAMKLFGSKKALVKERIRQKTAGHWVIHPCSS 79   southern house mosquito
XP_003241868   53 LRAVFEPSMNRLSMKIYGSEKAVLKERLRQRSLGAWIIHPCSK 95   pea aphid
XP_015224298   28 FGAMLQPGVNKFSLRMFGSHKAVEIEQERVKSAGFWIIHPYSD 70   spotted gar
XP_689197     124 FSSMLQPGVNKFSLRMFGSAKGVAAEQDRVKSFGVWIIHPYSD 166  zebrafish
XP_015208558   65 anyLLMPEMNKATISYFGSEEAVKKEKNRAEGQEKFVIHPYSS 107  spotted gar
XP_014344894   63 msKLLLPKASRRSLFFYGSANALMTESQRAEKLGTCIIHPFST 105  coelacanth
XP_013888580   18 WRALLLPQLNRQSLYVYGSEVAVEKECIRQLESGVFVIHPFSP 60   Austrofundulus limnaeus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap