2KRU


Conserved Protein Domain Family
PCP_red

?
pfam08369: PCP_red 
Click on image for an interactive view with Cn3D
Proto-chlorophyllide reductase 57 kD subunit
This domain is found in bacteria and plant chloroplast proteins. It often appears at the C-terminal of Nitrogenase component 1 type Oxidoreductases (pfam00148) and sometimes independently in bacterial proteins such as the Proto-chlorophyllide reductase 57 kD subunit of the Cyanobacterium Synechocystis.
Statistics
?
PSSM-Id: 400600
View PSSM: pfam08369
Aligned: 132 rows
Threshold Bit Score: 32.8258
Threshold Setting Gi: 288897811
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2KRU_A            6 WTAEAEKMLGKVP-FFVRKKVRKNTDNYAREIGEPVVTADVFRK 48  Chlorobaculum tepidum
Q8KCD9          170 WSDEARELVNNLPpFFA-DKIKGALYAYAEANGITYITPEVLDA 212 Chlorobaculum tepidum
Q3AUC8          157 WSLEAEELFQSVP-PFLQTKFKTLAEEYAEEMGYEEITLEVLDE 199 Chlorobium chlorochromatii CaD3
WP_011744108    158 WSDEAQDWLEVVP-GFLREKIRSMAAEYAIMNGYKEITVEMLDI 200 Chlorobium phaeobacteroides
Q1AYW8          679 WTEDAVARLERVPkGFMRNISRNMTEKLARKKGVREIDMPLIEE 722 Rubrobacter xylanophilus DSM 9941
jgi:TherJR_2505   3 WTEEALREMEKVP-GFVRKMAKSAVEKLAREKSVDEITVDLVQE 45  Thermincola potens JR
Q1AYW8          373 WTKEALERMDRVP-GFVVGMASGAVIRYAIEKGYTVITTSVIDE 415 Rubrobacter xylanophilus DSM 9941
WP_013247162    345 WTEEALRRMERIP-VFARGVAKTAIHRYAIEKGHTIISNTVVDS 387 Nitrospira defluvii
WP_041186657     58 WTDDARHRLDRVP-PYAVPVLRELVEGFARTRRQRVITYDLIDQ 100 Nitrospira defluvii
SLM44185        147 WTADAKEKLERLP-SFVKPMVQSSVEAYARKHGYKSITLQVMDD 189 Nitrospira sp. ND1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap