Conserved Protein Domain Family
TetR_C_2

?
pfam08361: TetR_C_2 
MAATS-type transcriptional repressor, C-terminal region
This family is named after the various transcriptional regulatory proteins that it contains, including MtrR, AcrR, ArpR, TtgR and SmeT. These are members of the TetR family of transcriptional repressors, that are involved in the control of expression of multidrug resistance proteins.
Statistics
?
PSSM-Id: 369831
View PSSM: pfam08361
Aligned: 9 rows
Threshold Bit Score: 183.71
Threshold Setting Gi: 82581662
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
wugsc:KPN_00445  84 DPLSVIREILVYVLEATVTEERRRLMMEIIYHKCEFVGEMTVVQQAQRQLSLASYERIEQTLKECIAAKLLPANLLTRRA 163 Klebsiella p...
WP_002208614     84 NPLRILRELLIYILVSTREDRRRRALMEIVFHKCEFVGEMTSVHDARKVLDLASYERIESVLQGCIDANQLPVNLNTHRA 163 Yersinia pse...
Q6D804           84 NPLRVMRELLIYMLRLTVSDTHWRSIMEIVFHKCEFVGEMLQSYNARKELYLSCYVDIEENLIECIRMGMLPTDIHPRRA 163 Pectobacteri...
Q8Y3G8           83 DPLGELRNVANFVLQQLVEDMHWRRVFEIMFNKCEFVEDTSPILKRQQESFEEGLARLTHIIGQAARRGQLPPDLDVPLA 162 Ralstonia so...
CAR40437         84 DPLFVLRELLIYILTSIVEDPKHNALLEIYFHKCEFVGEMTPIVEIRRELCAADYSRIEQSLSRCIEKKQLPANLDLRRA 163 Proteus mira...
Q7N0N2           84 NPLLILRTLIIHILTSVVDDPKNRLLMEIFFHKCEFVGEMSALVEVRQELCVADYVRIEESLSGCIASGQLPYNLHLRRA 163 Photorhabdus...
CCH:MU9_3223     84 NPLLVFKKILIYILTSVASDPKMRAILSISFHKCEFTGEMSELITIRQNLYAAEYSRIESFLIESVTLGLLPSTLDLRRA 163 Morganella m...
P0ACT2           84 DPFQQLREKLIVGLQYIAKIPRQQALLKILYHKCEFNDEMLAEGVIREKMGFNP-QTLREVLQACQQQGCVANNLDLDVV 162 Escherichia ...
Q8ZLN6           84 NPLQDLREKFIAALQYIAAVPRQQALMQILYHKCEFHNGMISEQAIREKMGFHHQSLLE-VLQRCMDKKLISGSLDLDVI 162 Salmonella e...
wugsc:KPN_00445 164 AVLMRSYLSGLMENWLFAPDSFDLHAEARDYVAILLEMYQ 203 Klebsiella pneumoniae subsp. pneumoniae MGH 78578
WP_002208614    164 AIIMRAYITGLMENWLFMPESFDIKQEAPVLIDAYLEMLG 203 Yersinia pseudotuberculosis complex
Q6D804          164 AIALRAYFSGVMENWLFMPESFDLDQEAPALVDAFIDMLH 203 Pectobacterium atrosepticum
Q8Y3G8          163 VAHFHASFGGIMGDYLFYPDASSLAVKRERFVDACIDTLK 202 Ralstonia solanacearum
CAR40437        164 AIMLRAMMTGLAENWLFSPESFSIKEESQYLVDSFIDMIK 203 Proteus mirabilis HI4320
Q7N0N2          164 AIMLRGLITGLLENWLFAPDSFDIQKEAESLVDSFIDMLK 203 Photorhabdus laumondii subsp. laumondii
CCH:MU9_3223    164 AIMLRGMITGLLENWLFSSESFNISGQAEYLVDGYLDMLM 203 Morganella morganii subsp. morganii KT
P0ACT2          163 MIIIDGAFSGIVQNWLMNMAGYDLYKQAPALVDNVLRMFM 202 Escherichia coli K-12
Q8ZLN6          163 LIILHGSFSGIVKNWLMNPTSYDLYKQAPALVDNVLKMLS 202 Salmonella enterica subsp. enterica serovar Typhimurium
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap