1QVT


Conserved Protein Domain Family
TetR_C_5

?
pfam08360: TetR_C_5 
QacR-like protein, C-terminal region
This family features the C-terminal region of a number of proteins that bear similarity to the QacR protein, a transcriptional regulator of the TetR family. QacR is able to bind various environmental agents, which include a number of cationic lipophilic compounds, and thus regulate the transcription of QacA, a multidrug efflux pump. The C-terminal region contains the multifaceted, expansive drug-binding pocket, which is composed of several separate, but linked, binding sites.
Statistics
?
PSSM-Id: 400592
View PSSM: pfam08360
Aligned: 4 rows
Threshold Bit Score: 170.104
Threshold Setting Gi: 228825632
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1QVT_A                   57 EESKWQEQWKKEQIKCKTNREKFYLYNELSL-TtEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGN 135
EEM71422                 65 SMRNWHDKWEIAEKQYTNATGKLYGIAKFVL-Y-NYKTPLLRAGQELASDPSANPSTIQQLYGLAVIPLKTYQKILDEGI 142 Baci...
tigr:GBAA_0389           62 HTYDWLEKWNEKEKLYSTSTEKLYALAEYHV-E-DIQQPISNAIEEFSMSQVVSKEILDEMLALTRESYVMFETLIEAGI 139 Baci...
PRJNA222409:SAZ172_p132  57 EESKWQEQWKKEQIKCKTNREKFYLYNELSLtT-EYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGN 135 Stap...
1QVT_A                  136 LNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLSK 188
EEM71422                143 QSGEFYIENVEDSSLLLGSWLGGLCQFIHSFETEKLEVLFNEAITIFLLSISN 195 Bacillus thuringiensis serovar ...
tigr:GBAA_0389          140 QSGEFREDNTRDLMYIVNGLLSGLGVLYYELDYKELKRIYKKAIDVLLKGMAA 192 Bacillus anthracis str. 'Ames A...
PRJNA222409:SAZ172_p132 136 LNGEWCINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLSK 188 Staphylococcus aureus subsp. au...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap