6TB4


Conserved Protein Domain Family
SCA7

?
pfam08313: SCA7 
SCA7, zinc-binding domain
This domain is found in the protein Sgf73/Sca7 which is a component of the multihistone acetyltransferase complexes SAGA and SILK. This domain is also found in Ataxin-7, a human protein which in its polyglutamine expanded pathological form, is responsible for the neurodegenerative disease spinocerebellar ataxia 7 (SCA7). Ataxin-7 is an integral component of the mammalian SAGA-like complexes, the TATA-binding protein-free TAF-containing complex (TFTC) and the SPT3/TAF9/GCN5 acetyltransferase complex (STAGA). This domain is a minimal domain in ataxin-7-like proteins that is required for interaction with TFTC/STAGA subunits and is conserved highly through evolution. The domain contains a conserved Cys(3)His motif that binds zinc, thus indicating this to be a new zinc-binding domain.
Statistics
?
PSSM-Id: 400555
View PSSM: pfam08313
Aligned: 41 rows
Threshold Bit Score: 76.0965
Threshold Setting Gi: 595495574
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6TB4_C        145 STAKPKGPVDVERQCGVPLP-NGGYCARSLTCKTHSMGAKRAVPGRSAPYDQLLVAYQRKN 204 
XP_001640134  182 VIPTREREFDADKHCGVWVAdQQKKCTRSLTCKTHALSLRRAVLGRRKPFDELLAEHKARV 242  starlet sea anemone
EFX71531      313 MLPVKERELDLEKHCGVWMSdLNRACTRSLTCKAHSLTLRRAVQGRSRSFDDLLAEHRAvk 373  common water flea
EEN58932      212 KIPLKDREYDPNKHCGVWLPdMKKPCTRSLTCKTHALSLRRAVPQRRKPFDELLAEHKARA 272  Florida lancelet
XP_781769     401 NVPCKDRRYDPDKHCGVWSDeHKRHCTRSLTCKTHSLSLRRAVQGRRLPFNELLAEHKARS 461  purple sea urchin
XP_027858457  328 NKKVSEREFNPDIHCGVMDAtGRKPCTRSLTCKTHSLGHRRAVPGRRKRFDILLAEHKNRT 388  Monterrey platyfish
XP_012311665  123 YRRLSEREFDPNKHCGVLDPeTKKPCTRSLTCKTHSLSHRRAVPGRKKQFDLLLAEHKAKS 183  Ma's night monkey
XP_002422675  258 SERKADKIYDPDKHCGVIND-NGKPCVRSILCKVHQVALKRAVPNRTMPYDMLIKILKNQN 317  human body louse
ELQ74188       38 KLHKIKKAFSVDRHCAV--PeNGVPCRNSLTCRVHSLDQRNEVKGRIYPVEDLIRILKREK 96   Trachipleistophora hominis
OWR55061      346 TKANNQREYDPNKHCGVVTAeNPKPCTRSLTCKAHALSLRRTVDGRSKPFDTLLAEHRASR 406  Danaus plexippus plexippus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap