5MQ0


Conserved Protein Domain Family
cwf21

?
pfam08312: cwf21 
Click on image for an interactive view with Cn3D
cwf21 domain
The cwf21 family is involved in mRNA splicing. It has been isolated as a subcomplex of the splicosome in Schizosaccharomyces pombe. The function of the cwf21 domain is to bind directly to the spliceosomal protein Prp8. Mutations in the cwf21 domain prevent Prp8 from binding. The structure of this domain has recently been solved which shows this domain to be composed of two alpha helices.
Statistics
?
PSSM-Id: 400554
View PSSM: pfam08312
Aligned: 151 rows
Threshold Bit Score: 27.3987
Threshold Setting Gi: 754401411
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5MQ0_R         67 HMEKREIEVQVSELRDRLEEEEtLSEEQIDKKCEALRAKLTNE 109  baker's yeast
EKC18006       72 HERKRKVELKCMEMQVLMEEQG-YSAEDIEKKVTMFREMLVNK 113  Pacific oyster
XP_006000933   59 HERKRKVELKCLELEEMMEEQG-YSEGEIQEKVATFRQMLIEK 100  coelacanth
XP_001639492   59 HQKKREVELKCMELQDMMEEQG-YDDAEVQLKVTQLRAFLTEE 100  starlet sea anemone
CBJ26784       93 HQRKRKVEAKIFELQEAMADRG-YSDAEIEEKVAEVRKGLEER 134  Ectocarpus siliculosus
CDS40964       59 HEKKRQVEVRCFELQQAMEDQG-YTEGEIDEKVSALRKELISR 100  Echinococcus multilocularis
XP_015793085   60 HQRKRKIELKCVELETQMEDEG-CTQEEIDKAVARLREKLKAR 101  two-spotted spider mite
RLN53523       65 HEQKRKVELQLLEMSLEMEDRG-CDPEEIQDKVKRERERLLAR 106  Phytophthora kernoviae
XP_030848175   59 HKRKRQVELKCTEMKEVMEEQGtYSKEEIEKKVIAFRKMLFEk 101  purple sea urchin
XP_029293064   62 HQRKRQLEVKCAELQDMMEEQG-YSAEEIEEKVNTFRMMLQEK 103  Cottoperca gobio
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap