Conserved Protein Domain Family
AAA_PrkA

?
pfam08298: AAA_PrkA 
PrkA AAA domain
This is a family of PrkA bacterial and archaeal serine kinases approximately 630 residues long. This is the N-terminal AAA domain.
Statistics
?
PSSM-Id: 116881
View PSSM: pfam08298
Aligned: 7 rows
Threshold Bit Score: 528.181
Threshold Setting Gi: 730399
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q92QD4  24 ISLQEYLLACRDDKSMYATAQERMVDAIGDP---ILVDTSADERLGRIFANRTIKIYPAFS-DFFGMEDTIERIVG-YFR 98  Sinorhizobium meliloti
Q89FE5  22 MSMAEYLESCRSDPMKYANAAERLLAAIGEP---QTIDTAKDPRLGRIFLNRTIRTYPAFA-GFYGMEETIERIVG-FFR 96  Bradyrhizobium japonicum
P39134  21 GTFADYLEIIKENPMVAQSAHSRVFNMIKDSgieEI---------------DGRKKYSFFDrELFGLEESLERLVEeYFH 85  Bacillus subtilis sub...
Q8XKR0  21 GTFLDYLEIVKNNPDVAKLSHKRIYDLIMDKg-fEILRPEENAKIKKIYGNEKIKRYNFFKeDFYGIDTVVMKLMN-YFH 98  Clostridium perfringens
Q896G7  25 CSFLDYLDIVKENPEVCKFAHKRIYDLIIKQgfhI------------VDKNESIKKYNFFGeDFFGIDKTLMKIVN-YFY 91  Clostridium tetani
Q88A50  19 LSLQEYLELCKQDRSAYASAAERLLLAIGEP---ELVDTSANSRLSRIFSNKVIRRYPAFA-DFHGMEECIDQIVS-YFR 93  Pseudomonas syringae ...
P0ACY3  19 FTLQEFLTTCRQDRSAYANAAERLLMAIGEP---VMVDTAQEPRLSRLFSNRVIARYPAFE-EFYGMEDAIEQIVS-YLK 93  Escherichia coli K-12
Q92QD4  99 YAAQGLEERKQILYLLGPVGGGKSSLAERLKKLMELR------PIYTLmvdgKISPVFESPLGLFHPERMADLLEDKYGI 172 Sinorhizobium meliloti
Q89FE5  97 HAAQGLEERKQILYLLGPVGGGKSSLAERLKSLMEVH------PIYVLkagdELSPVFESPLSLFDPDQLGPMLEEKYGI 170 Bradyrhizobium japonicum
P39134  86 PAAKRLDVRKRILLLMGPVSGGKSTLVTMLKKGLEAYtltdngAVYAI----KGCPMHEDPLHLI-PHHLRDDFYREYGI 160 Bacillus subtilis sub...
Q8XKR0  99 SASMRGEEARQVLYLVGPVGAGKSSLVESIKRVLETAp-----PVYVL----DGCPMHEEPLHLI-PKHLRKEFGDMLGV 168 Clostridium perfringens
Q896G7  92 AASMEGEESKQVLYLVGPVGSGKSSIVEAIKIALEDSe-----PIYAL----ENCPMREEPLHLI-PNNLRRKFEKELDL 161 Clostridium tetani
Q88A50  94 HAAQGLEEKKQILYLLGPVGGGKSSLAEKLKQLIEKV------PFYAI----KGSPVFESPLGLFNASEDGAILEEDFGI 163 Pseudomonas syringae ...
P0ACY3  94 HAAQGLEEKKQILYLLGPVGGGKSSLAERLKSLMQLV------PIYVLsangERSPVNDHPFCLFNPQEDAQILEKEYGI 167 Escherichia coli K-12
Q92QD4 173 ARRRLTGLISPWASKRL-DEVGGDISKFSVVKLMPSRLRQIGIAKTEPGDENNQDVSSLVGKVDIRQLENY-SQADPDAY 250 Sinorhizobium meliloti
Q89FE5 171 PRRRLTGLMSPWCYKRL-EAFGGDISQFRVAKIQPSRLRQIAIAKTEPGDENNQDISSLVGKVDIRKLETY-AQNDPDAY 248 Bradyrhizobium japonicum
P39134 161 ---RIEGSLSPLNVMRLeEEYGGRIEDVKVERIFFSEDKRTGIGTFSPSDPKSQDIADLTGSIDFSTIAEYgSESDPRAY 237 Bacillus subtilis sub...
Q8XKR0 169 ---EIEGDLCPVCKYRLlNEFGGEYEKFPVSTKNFSIRSRKGIGVVPPVDPNNQDTSILTGSIDISKMDMY-PEDDPRIF 244 Clostridium perfringens
Q896G7 162 ---KIEGDLCPVCTYRLrEEFNGEIEKFPVQKIGFSIKERRGVGVVPPVDPNNQDTSVLVGSVDISKMDIY-SEHDPRIF 237 Clostridium tetani
Q88A50 164 PRRYLSTIMSPWATKRL-AEFGGDISQFKVVKLYPSVLNQIAVAKTEPGDENNQDISALVGKVDIRKLEEF-PQNDADAY 241 Pseudomonas syringae ...
P0ACY3 168 PRRYLGTIMSPWAAKRL-HEFGGDITKFRVVKVWPSILQQIAIAKTEPGDENNQDISALVGKVDIRKLEHY-AQNDPDAY 245 Escherichia coli K-12
Q92QD4 251 SYSGGLNRTTQGLLEFVEMFKAPIKVLHPLLTATQEGSYNGTENFGAFPFQGTILAHSNESEWLQFKNNRNNEAFLDRIL 330 Sinorhizobium meliloti
Q89FE5 249 SYSGGLNRANQGILEFVEMFKAPIKMLHPLLTATQEGNYIGTENIGAIPFTGIILAHSNEAEWASFKANKNNEAFIDRIC 328 Bradyrhizobium japonicum
P39134 238 RFDGELNKANRGMMEFQEMLKCDEKFLWHLLSLTQEGNFKA-GRFALISADELIVAHTNETEYRSFISNKKNEALHSRII 316 Bacillus subtilis sub...
Q8XKR0 245 SLNGAFNVGNRGLVEFIEVFKNDVEYLHTIITATQEKSIPSPGKGSMIYFDGLIIAHSNEAEWNKFKSDHTNEAILDRIV 324 Clostridium perfringens
Q896G7 238 SLNGAFNVGNRGIVEFIEIFKNDIEYLHSIITATQEKLIPSPGKGSMVYYDGVIIAHSNEGEWNKFKSDPTNEAILDRIV 317 Clostridium tetani
Q88A50 242 SYSGALCRANQGLMEFVEMFKAPIKVLHPLLTATQEGNYNSTEGLGAIPFTGILLAHSNESEWHSFRNNKKNEAFIDRIY 321 Pseudomonas syringae ...
P0ACY3 246 GYSGALCRANQGIMEFVEMFKAPIKVLHPLLTATQEGNYNGTEGISALPFNGIILAHSNESEWVTFRNNKNNEAFLDRVY 325 Escherichia coli K-12
Q92QD4 331 VVKVPYCLRVTEEKQIYEKLLRESELVSNPCAPEVLEILSRFTVSTRLVPHENSS 385 Sinorhizobium meliloti
Q89FE5 329 VIKVPYVLRVTEEQKIYEKLIQGSELASAPCAPSTLETMARFSVMSRLRKHENST 383 Bradyrhizobium japonicum
P39134 317 VMPVPYNLKVSEEERIYEKMIAESDVADVHIAPHTLKVAAMFSILTRLKEPKRSD 371 Bacillus subtilis subsp. subtilis str. 168
Q8XKR0 325 KIEVPYCLELSEEIKIYEKILKKSNF-DAHIAPHTMEIASMFAILTRLLPSMKVD 378 Clostridium perfringens
Q896G7 318 KIEVPYCLELDEEKKIYKKILKNSNF-QVHIAPHTIDVAAMFAILTRLNSSEKVD 371 Clostridium tetani
Q88A50 322 IVKVPYCLRVSDEIKIYDKLLFNSSLAKAHCAPDTLKMLAQFTTLSRLKEPDNSN 376 Pseudomonas syringae pv. tomato
P0ACY3 326 IVKVPYCLRISEEIKIYEKLLNHSELTHAPCAPGTLETLSRFSILSRLKEPENSS 380 Escherichia coli K-12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap