Conserved Protein Domain Family
RVP_2

?
pfam08284: RVP_2 
Retroviral aspartyl protease
Single domain aspartyl proteases from retroviruses, retrotransposons, and badnaviruses (plant dsDNA viruses). These proteases are generally part of a larger polyprotein; usually pol, more rarely gag. Retroviral proteases appear to be homologous to a single domain of the two-domain eukaryotic aspartyl proteases.
Statistics
?
PSSM-Id: 400537
View PSSM: pfam08284
Aligned: 7 rows
Threshold Bit Score: 216.914
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EYU31709      411 TQGRVYSVvrapNLAEESSNPSVAQGTFLVFNSWASVLIDTGASHSFISLAFALSLGLKIEALDVPLCIDTPVSGGVTLR 490  spotted monke...
KYP66422      172 TTGRVFAL----SGAEATQSEDLIQGMCFINGTPLTVLYDSGATHSFISHACVSKLKLPVSSLSFELIVETPTSESVITS 247  pigeon pea
KYP33123       72 ATGRVFAL----SGAKATQFEDLIQGMCFINGTPLIVLYDSGATHSFISHACVSKLKLPVSSLSFELIVETPTGGSVSTS 147  pigeon pea
BAS93193      373 IRGRVNHV----TAEDVLTTPDVIVGTFLVHSIPATILFDSGASHSFISVPFVGKNQLGVERLRNPLLITTP-GGVMTAK 447  Japanese rice
BAT17244      379 IQARVNHA----SAEEAQAAPEVVLGTFPVNSIPATVLFDSGATHSFISKKFVGMHGLIREELSTPMRVHTP-GNSSTSV 453  Japanese rice
1_pfamImport    3 VRGRVNHI----SAEEAEAAPDIILSTFLVNSIPATVLFYSGDSHSFISRSFVWKHKLRVENLSNPMMISTP-GSQMSCN 77  
EEC68140       91 G---VYNL----TKNTAEESNTVVTGNVLVCSYPGKVLFDSGATHSFISTNFVRKYTIPTSQLKERICIETPLDSQIT-N 162  long-grained ...
EYU31709      491 EICRSCEIKIADHSLVFDLIILDMVSFDVILGMDWLSAYRANIDCYRRRVTVSTARGS 548  spotted monkey flower
KYP66422      248 DVCSKCPLTIEGRDFMVDLICLPLSQLDVILGMDWLSSNHVLLNCASKSIIFGESVEK 305  pigeon pea
KYP33123      148 YVCLKCPLSIDGINFMVDLICLPLSQLDVILGMDWLSSNHVLLNCADKSIVFGKPIEK 205  pigeon pea
BAS93193      448 YYSPAVPIEIQGIPFPSDLILLDTKNLDVILGMNWLAQFQGVVDCARRTVTLYRGPEQ 505  Japanese rice
BAT17244      454 QFSPSITIEIQRSPFLANLILLESKDLDVILGMDWLTKFKGVIDCANRTVTLTNEKGE 511  Japanese rice
1_pfamImport   78 LFSPSVSIEIQGISFLANPILLNSKNLDVILRMDWLTKNSRQQVIFQAKVALTKE-SL 134 
EEC68140      163 LICKLCPITIDGWELTADLIPLDMHDFDIILGMDWLCKNKANIDCHEKQITLKPWDQN 220  long-grained rice
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap