4CXF


Conserved Protein Domain Family
Sigma70_r4_2

?
pfam08281: Sigma70_r4_2 
Click on image for an interactive view with Cn3D
Sigma-70, region 4
Region 4 of sigma-70 like sigma-factors are involved in binding to the -35 promoter element via a helix-turn-helix motif.
Statistics
?
PSSM-Id: 400535
View PSSM: pfam08281
Aligned: 141 rows
Threshold Bit Score: 36.665
Threshold Setting Gi: 445989034
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4CXF_A 128 LARVASTLGKLDTGSREVIVLTAIVGMSQPEAAAVLGLSVKAVEGRIGRARAKL 181 Cupriavidus metallidurans CH34
Q89EB7 115 RLMFICCHPQLPATQQIALALRIVSGLTVKQIARAFLVSEAAMEQRITRAKAKV 168 Bradyrhizobium japonicum
Q9AB45 105 RLIFVCCHPAVAPESRAALTLRLVCGLSVAEIARAFLVAEPAMFQRLTRAKKKI 158 Caulobacter vibrioides
Q9I114 112 LEEISRMLDGLKPKVRTAFLLAQCEDLSHRQIAERMGVSQRSVERYVAEALYHC 165 Pseudomonas aeruginosa
Q8L1U9 108 LDQIDTLLSALPLKTRRAFLLAQVEQLPYAEIAEQLQISVRTVQRHILRAYEQC 161 Bordetella avium
Q82VI5 110 LHEIDRMLDSLAPKVRQAFLLSQIEGLKYEVIAEQLGVSLGSVKRYMQQAFRQC 163 Nitrosomonas europaea
Q9I265 109 LLRLERMLAGLSPKARAAFIHSQIGGLTYVEIACLLEVSVSRIHQYMVEGFKQC 162 Pseudomonas aeruginosa
Q9HXB4 110 LVELDRLLDGLPPLAKETFLLAQLDGLGYAEIATQLGISLSSVKRYMLKAAQRC 163 Pseudomonas aeruginosa
Q9AAN6 101 LDRLRAAILTLPRQERLVLMMHRIEGRKLTEISESQRIPLRTVQQLLAQALARC 154 Caulobacter vibrioides
Q82T05 106 CRLLLDTIASMPQGCRDVFLLRKIDGLSYSEISIRLNISEKTVQRRLVQAMLRC 159 Nitrosomonas europaea
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap