Conserved Protein Domain Family
DASH_Hsk3

?
pfam08227: DASH_Hsk3 
DASH complex subunit Hsk3 like
The DASH complex is a ~10 subunit microtubule-binding complex that is transferred to the kinetochore prior to mitosis. In Saccharomyces cerevisiae DASH forms both rings and spiral structures on microtubules in vitro. This family also includes several higher eukaryotic proteins. However, other DASH subunits do not appear to be conserved in higher eukaryotes.
Statistics
?
PSSM-Id: 400503
View PSSM: pfam08227
Aligned: 42 rows
Threshold Bit Score: 40.2247
Threshold Setting Gi: 68052170
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CCE64119       6 QRQYSRLAEQLSQLQDNLEEATQHLDTMSKQCNTniINQLGKLHASW 52  Tetrapisispora phaffii CBS 4417
Q753W8         6 RRHYSQLSQQLQLLQKNLEATTQHVETMSVQCNEhlVNKLGKIQASW 52  Eremothecium gossypii ATCC 10895
NP_001138275 179 AREKNHLILENETLCRNLSHTAEQLERMSIQCDVwrSKFLASRVMAe 225 zebrafish
CCK68277       6 ERQYTYLANQLQSLQSNLQTTRDELEMLSLQCDKnlVGQLGKINASW 52  Kazachstania naganishii CBS 8797
XP_003957074   6 kRQYAYLAQQLQQLQTNLQTTKDEMSVLSSQCNKniVGQLGKINASW 52  Kazachstania africana CBS 2517
EJT42352       6 QRQYNQLAHELRELQTNLQETTKQLDVMSKQCNEnlIGQLGKVHGSW 52  Saccharomyces kudriavzevii IFO 1802
XP_002498859   7 ERQYAHMAQQLQVLQANLAETSRQLEVMSRQCNKniVGQLGRVHASW 53  Zygosaccharomyces rouxii
EDO19611       6 QRQYARLAEQLELLQHNLLNTTEHLDVMSRQCNNniVDQLGKVSASW 52  Vanderwaltozyma polyspora DSM 70294
CAR56743       5 QRQYARLAAHLKQLRENLDETTAQVEIMANQSNM--ITKLGAVQAST 49  Kluyveromyces lactis
Q5KFQ3         8 QRHYSALASRIRSLHANLAETEGLLDMMTHQLDA--TAKIGVHCGSQ 52  Cryptococcus neoformans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap