Conserved Protein Domain Family
DUF1719

?
pfam08224: DUF1719 
Domain of unknown function (DUF1719)
This is a domain of unknown function. It may have a role in ATPase activation.
Statistics
?
PSSM-Id: 400501
View PSSM: pfam08224
Aligned: 32 rows
Threshold Bit Score: 290.296
Threshold Setting Gi: 242042832
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002465096 111 SSSLPTRLVHATTSF-VS---SILlsaRNrtdaaadaDADDdgcgwSGGSAVRRFEWFADGAAEFLRFVElGGTPwPRYT 186 sorghum
XP_002459287  96 SSSYLQRIANRAANLsIS---SLV---GL--------SKEP-----LSFSVATTFERYADWAEKFVAEVE-SSCP-LRHV 154 sorghum
XP_004980830 102 rHSFSKWIAHVTQSS-VS---SYFt--GF--------CKDN-----ISCSDVRRNEWFAECANRFLRDVEsGCSP-LRCV 161 foxtail millet
EMS66339      90 vrsLRRKIMHAV----LP---SFI---VP--------NQDA-----LSSSVVGRFEQFVKEADRFVRDVEsGSSL-SHYR 145 Triticum urartu
Q0D8X7       132 hSYFPKQFVQAVKAM-KSyvlSFL---GM--------NKQYl----LSCSHVRRFEWFAKKAGKFARDVEtGRTL-WHYN 194 Japanese rice
XP_010232802 102 HSSFPRRIAHTTKAF-IS---SFV---GR--------DNDHc---sDNIAAVRKFERFADGATEFMRFVQfGGTP-RQHL 162 stiff brome
XP_010232799 102 QSSFPRRIAHTTKAI-IS---SFL---SR--------NNDHc---sYNISDVRRFERFADGATEFMRFVQlGGTP-RHPL 162 stiff brome
EMS46285     102 QSSLPRRIAHTTKTF-IS---SFV---GR--------KNDHc---sDNITSVRRFERFADGATEFIRFVQlGGTP-RHHM 162 Triticum urartu
5_pfamImport   1 KSSFPRRVAHTTKTF-IS---SFI---RR--------GNDHfsagrVTAAAVRRFERLADDAGEFMRYVQlGGTP-RHHL 64 
CDJ26475     105 KSSFPRRMAHATKVF-IS---SFV---GH--------DNGHrsagsATTAVVRRFERLADGADEFIRYVQiGGTP-RQNL 168 bread wheat
XP_002465096 187 FFD-PLIARLLAGEEARYRL-VR-GSQYYLFCVRPIVLEGRGTEAKLIFFYEDDDAPEKNLCIGTMLRLSESTDIVGITI 263 sorghum
XP_002459287 155 TFRyPFLRHLFEGKTLVCKM-VKnPSQSLRFYLHPVIVEGRGVEVKLVYVYEDCRTLEKYFYVSMNLRISEDTDIIGIII 233 sorghum
XP_004980830 162 FSN-PLVRQLLEGKTLEYKM-VQ-GSILRCLHIQSMCVEGRGVEATLEFRYEDRKTPMRSFSLKLMLRLSESTDIIGTAI 238 foxtail millet
EMS66339     146 FLS-SPIRHLLEGKGLYYDM-VQ-GSKAFSLGISTDSVEEYGRVAWLCFHYKDRKAPLKTCRLVVALRLYESTNIVGITA 222 Triticum urartu
Q0D8X7       195 FFS-SLIRPLLEGKHLKYDMpLQ-GSKTLGITIVPVSLEGRGVEALIQLNKEDSRMPLKNFCLLLILRLSESTDIVRIII 272 Japanese rice
XP_010232802 163 FFD-PLIGHIFAGKSIRYMG-LLpGARHHFFSLWPIAFEERGLEAMLFYAYEDCKVLENSFALGFMMRVLESTDIIGTTV 240 stiff brome
XP_010232799 163 FFD-PLVGHIFAGKFIRYMV-LHpRGGYHCFAIQPVVSEERGLEVTLYFLYEDCKVFENSFTLGLMMRISESTDIIGTTV 240 stiff brome
EMS46285     163 FFD-PLIRHIFEGKSIRYMV-LHpGGQYHFFTIQPIASEERGLEAILCFVYEDCKLPEKSFALKFMMRISESTNLIGTTV 240 Triticum urartu
5_pfamImport  65 FFD-PLIGHIFAGKTLTYQV-LQpGGQYHFFRIHSVGFNDRGLEATITFIYEDRKVPKNNFRLGLMMRLSESTDIIGTTV 142
CDJ26475     169 FFD-PLIGHLFTGKMIAYQL-LRpGGQYQYFRIGPINFQERGLEAFLSFMYEDCKVPKNSFCLGVMLRLSESTDIIGTVV 246 bread wheat
XP_002465096 264 QCLQLLvTPHFKSTAEAATRELANL-PTQ---DFS--WVPygg--stHREHWDSIHKDM---SQWFRPDPLCC-NHHEPc 331 sorghum
XP_002459287 234 KCMQWL-TAKFKLAVESAIGELKLLpSLQ---DIFhsSVPp------PSFMIEEKHGFY---SKFFRPDPICC-KGNSH- 298 sorghum
XP_004980830 239 RCLQSF-MSSMKDVTEAAVRELTQL-PLQ---DISh----------sHAASCFTIKDLCsydTHLWRPDPLCCkP----- 298 foxtail millet
EMS66339     223 KCLRSL-GPQFKSLVEDATGELSHL-PTQ---DVS--YF--------DSVMWECMVKL----TTESIPDPFCCiANGLS- 282 Triticum urartu
Q0D8X7       273 NCLQLL-GPHFTRLAKDAIGQLAAL-QHShpqDLEplLALqa---vdYHRSFLAFR------ATVARPDPFCC-REKRL- 339 Japanese rice
XP_010232802 241 KCLRLV-TPHFKSTADVVTKEIMQL-PTQ---DFS--CLPlevananVEQYWNDIHTTF---AGWFRPDPLCC-QGYEH- 308 stiff brome
XP_010232799 241 KCLGLV-TPHFKSTADIVIKEITQL-PTQ---DFF--CSPpevtsadAKNHWTEMHTTF---STWFRPDPLCC-QGYEH- 308 stiff brome
EMS46285     241 KCLQLV-TPHFKSTAEIVIKEIAQL-PTQ---DFS--CLPpevmsvnAEHYWNEMNTTF---AVCSRPDPLCC-QGYEH- 308 Triticum urartu
5_pfamImport 143 KCLRLV-TPHFKCTADVVIREITHL-PTQ---DFS--YFA-------HVQHCDHIHRTL---TKWFRPDPLCC-QGYDH- 203
CDJ26475     247 KCLRVM-TPHFNSMTDVVIKEITHL-PTQ---DFS--CVA-------HEKHWVHVHRTL---TEWFRPDPLCC-QGFEH- 307 bread wheat
XP_002465096 332 rrrrrlRESNAAAGTVrpwp--------sqvsLESVIEVYWQCQ 367 sorghum
XP_002459287 299 ------GTLASKSSMEi---------------PEPVIEIYFSCY 321 sorghum
XP_004980830 299 ------DGCPTSYIPSels----------ckfPEQIILIHVVCY 326 foxtail millet
EMS66339     283 ------KPCASNIISSelt----------grfPQEVLFVVFNCc 310 Triticum urartu
Q0D8X7       340 ------DPCADNTISPnlp----------ydiPEQVIYVRCSSY 367 Japanese rice
XP_010232802 309 ------NVVPSCRGGEsingrkl---rlssifPEPVGLVFLQRH 343 stiff brome
XP_010232799 309 ------DSVSSCGGGEsssgnkl---rlssifPEPVCQVSLQRS 343 stiff brome
EMS46285     309 ------KIVSSCRGDEsnsgnkl---rlssifPEPVCKVFLQRH 343 Triticum urartu
5_pfamImport 204 ------DVVPSSRGGSncnngggnkfrfssifPESVCEVFLLR- 240
CDJ26475     308 ------DVVPSFHSGSdisngsgnklkfssifPEPVCQVFFQCH 345 bread wheat
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap