6AQR


Conserved Protein Domain Family
Sgf11

?
pfam08209: Sgf11 
Click on image for an interactive view with Cn3D
Sgf11 (transcriptional regulation protein)
The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae. The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation.
Statistics
?
PSSM-Id: 369754
View PSSM: pfam08209
Aligned: 31 rows
Threshold Bit Score: 50.2572
Threshold Setting Gi: 281206114
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6AQR_C         67 SSQYIHCENCGRDVSANRLAAHLQRCLSRGARR 99   Saccharomyces cerevisiae S288C
XP_002508840  173 SKEATTCPLCLQQMAASRFASHLERCLGKGRTA 205  Micromonas commoda
Q5FC18         68 NVPYYSCLMCKREIAASRYAAHLEKCKGRSLSN 100  Schizosaccharomyces pombe 972h-
XP_002174737   68 TVPYYNCEGCGRQIAASRYAAHLEKCKGRTHsv 100  Schizosaccharomyces japonicus yFS275
EEA26959      191 DYPTIKCPNCPRYCQTNRVAAHLDRCMGISGRT 223  Talaromyces marneffei ATCC 18224
EDU49076     1052 YIPWHTCPNCKRSLLITRFAQHLEKCLGISGRQ 1084 Pyrenophora tritici-repentis Pt-1C-BFP
EEY69420       53 DSVFVSCLYCKRQVHASRYTNHLEKCMT-GSRR 84   Phytophthora infestans T30-4
EFA80303      162 ALVLVVCNNCSKTIKQSRFVSHYERCIQ-DEDP 193  Heterostelium album PN500
XP_001874281  109 GTAFLDCVSCGRQIASNRYAPHLSNCMGLASSR 141  Laccaria bicolor S238N-H82
KIS70821       95 NNPLFECLICSRQVSSNRYATHLAKCMGVGSKG 127  Ustilago maydis 521
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap