2OMY


Conserved Protein Domain Family
LRR_adjacent

?
pfam08191: LRR_adjacent 
Click on image for an interactive view with Cn3D
LRR adjacent
These are small, all beta strand domains, structurally described for the protein Internalin (InlA) and related proteins InlB, InlE, InlH from the pathogenic bacterium Listeria monocytogenes. Their function appears to be mainly structural: They are fused to the C-terminal end of leucine-rich repeats (LRR), significantly stabilizing the LRR, and forming a common rigid entity with the LRR. They are themselves not involved in protein-protein-interactions but help to present the adjacent LRR-domain for this purpose. These domains belong to the family of Ig-like domains in that they consist of two sandwiched beta sheets that follow the classical connectivity of Ig-domains. The beta strands in one of the sheets is, however, much smaller than in most standard Ig-like domains, making it somewhat of an outlier.
Statistics
?
PSSM-Id: 369739
View PSSM: pfam08191
Aligned: 10 rows
Threshold Bit Score: 71.2443
Threshold Setting Gi: 81849931
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2OMY_A    404 GALIAPATISDGGSYTEPDITW-NLP-SYTNEVSYTFSQPVTIG-KGTTTFSGTVTQPLK 460  Listeria monocytogenes EGD-e
Q7AP87    286 GAPIAPATISDNGTYASPNLTW-NLT-SFINNVSYTFNQSVTFK-NTTVPFSGTVTQPLT 342  Listeria monocytogenes EGD-e
Q8Y8U2    335 GNIVTPNNISDNGTYNSPTLSW-NLN-ETKDNLSYDFTTKITIL-NINATYSGTVIQPLT 391  Listeria monocytogenes
Q8Y7Y3    330 GSRVQPSKVSHAGVYANGEITW-EGL-QSNYILNYEYALPVTIG-SLTTTYSGKITQPLL 386  Listeria monocytogenes
CAD00789  220 GEVVPPTTISNNGTFASPNITW-NLD-SFTSEVSYDFNQKITLGdNGKVTFAGTVVQPIV 277  Listeria monocytogenes EGD-e
Q8Y9W0    398 GTLIAPETISNNGTYDAPNLKW-SLP-NYLPEVKYTFSQKIPIG-TGTSNYSGFITQPLK 454  Listeria monocytogenes
P0DQD2    264 GSLVTPEIISDDGDYEKPNVKW-HLP-EFTNEVSFIFYQPVTIG-KAKARFHGRVTQPLK 320  Listeria monocytogenes EGD-e
Q8YAF5    370 GQMVTPKIISNNGTYSDQSIAWaSGElSGLSKVSYTFDEVINSP-AIAGKYTGTVNQPIE 428  Listeria monocytogenes
Q8Y6A8    239 GRWISPYYISNGGSYVDGCVLW-ELP-VYTDEVSYKFSEYINVG-ETEAIFDGTVTQPIK 295  Listeria monocytogenes
Q8YA32    809 GTLLAPSSIGNSGNYKDGKITWtNMT-ATSSSTLFNFNRL-----KDGLTFSGTVTQPYK 862  Listeria monocytogenes EGD-e
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap