6AGB


Conserved Protein Domain Family
POPLD

?
pfam08170: POPLD 
POPLD (NUC188) domain
This domain is found in POP1-like nucleolar proteins.
Statistics
?
PSSM-Id: 400475
View PSSM: pfam08170
Aligned: 142 rows
Threshold Bit Score: 81.4502
Threshold Setting Gi: 443897793
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6AGB_B                    555 DWIVVLPWFWL-LPLWHLLNRIPrMYHIGLRQFQQIQYENKQLYFPDDYPFTQLGYIENSFYKKEAsKTKWDRKPMGKRI 633 
Q11188                    402 GADILIPEPFA-KDFWVSLQRRG-VRASGLRDEYAAHLESKALYYPLDDVGSEAGRESELAMKKEL-IEKYLGKPHNRRC 478  C...
6_pfamImport                1 GWDIVCPPASV-PSLLKTLVFGG-ALVVGLEEDAALSTVLHQPSFPCDYPDTQAGQAHWEARARDL-ATEQAKKPKSKRV 77  
7_pfamImport                1 GWDIVCLPSSV-SSILKTLVFGG-AMVVGLEEDAALHTALHQPSFPCDYPDAQAGQVYWEARARDL-VIEQAKKPKAKRF 77  
Q4UB06                    471 GVDLLIPPNSNsNKLWILLNRFG-GLSIGLTERRHLMNHFHLPSFPHDFPETELGQLYYKNLFKTE-SNKYAMRPANKRV 548  T...
CAQ37909                  765 RYLILSPARKKsSVLFQLLVRNG-CIAIGLKEREKILKCSDFLCYPKDFPDSHGGILYNKFREELA-RNKYFKKPLRKRI 842  P...
XP_002808770              798 RYFIVCPAKKKcSTLFHLLIRNG-SIAIGLKEREKILKCCNFLTYPKDFPDTSGGISYNKLREDIS-TNSYFQKPINKRV 875  P...
WGS:AFBI:EDEG_03521       385 NGKILVNRKNI-MNIWQFFCNNG-VIPISILEHLRLGLEYKKMIFPYDFPNTCFFNDFEKSCYKHV-EEKYLRTPASKKP 461  E...
ESS30442                  987 GIDLFLPVSSAvARLFVLLCRYG-ARPIGCRDRRKLLLESGAPDFPFDFPDSQAGTHAALCAAWQD-ELRHHRKPPGKRV 1064 T...
WGS:AAFB:cds.EHI_127090A  396 GYFLIVPSLFA-LTCWRRIVWHC-VLPLALKERKYLTYEAGLMTYPDDYVDNEYSQQMSEEQKDIL-IKQASLKPKSKKM 472  E...
6AGB_B                    634 NFekikdihntklpaysgeIGDFFSS--DW 661 
Q11188                    479 KHwsa------------vsVKYPFEF--KW 494  Caenorhabditis elegans
6_pfamImport               78 NFkk-------------hgVTSPFQP--QW 92  
7_pfamImport               78 GNgk-------------hgVNSPFRP--RW 92  
Q4UB06                    549 NYsf-------------lgVDNAFVLpvNl 565  Theileria annulata
CAQ37909                  843 NYyc-------------lgINSPFNY--SW 857  Plasmodium knowlesi strain H
XP_002808770              876 NYyc-------------igINNPFNY--SW 890  Plasmodium falciparum 3D7
WGS:AFBI:EDEG_03521       462 NYek-------------lgVENPFYLpesv 478  Edhazardia aedis USNM 41457
ESS30442                 1065 NFav-------------naTPCPFFP--TW 1079 Toxoplasma gondii VEG
WGS:AAFB:cds.EHI_127090A  473 NIqrf-----------svqNQIPWEM--NW 489  Entamoeba histolytica HM-1:IMSS
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap