Conserved Protein Domain Family
NUC194

?
pfam08163: NUC194 
NUC194 domain
This is domain B in the catalytic subunit of DNA-dependent protein kinases.
Statistics
?
PSSM-Id: 400469
View PSSM: pfam08163
Aligned: 18 rows
Threshold Bit Score: 448.333
Threshold Setting Gi: 514698054
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
KOF80019      270 RKFVIKKVCLPFLRNMSKIPFVEFLKSNIPAIVNIVEAEITQLSe-dLMEQHLTDKMCCFQILEIMYRSMDVKELNGPGS 348  Octopus bimac...
EKC33407     1689 RRTTIEKVALPILRLVHKSALLEFFTDHMGDLRTTVEAKLVKGS---GLENQLTSKLCCFQLLELMYGRLSKEEVFGKSS 1765 Pacific oyster
XP_009052558 1627 RIAALSRVCLPMLRLVHKSAVIEFFLTHISFIMSEIEAKLVKGSk-aELENQLTTKIGCFQLMELLYSRLTKDEVNSKNS 1705 owl limpet
EDO34281      206 RLAVLDRVSVTLLCNASKAGVSEFFSSHVKEIMEIIEAKQLKTYd-pGFESQLVSKMCAFRMIEVLYSRLGKAELNSPQS 284  starlet sea a...
XP_004996596 1699 RRGVAQRVLATFLQACKLSMCSAFYIKRLPAIMSLMSQDTPLTSt-----pAIVIKMCTFTLIDILFQRLNTTDLYGKSA 1773 Salpingoeca r...
XP_001848795  959 RLTVLKRFLISGLRMCSFEALSTFYKSNIKKINDMIRSNYGQFGsgwEAEQALINRFGGYQLIELYVAVLPRDVILSDDC 1038 southern hous...
KMQ98034     1596 RLDVLHRFLLPTFKFCDTIAIERFFERNIRQLHDYAYPFIGATDe-tRTKEIIVSKIGCFQLITIMFATVDMNKIVGVNA 1674 Lasius niger
XP_012056011 1494 RLDILHGFLLPAFKFCDSIAIERFFDRNYKVLYDYYIDFLNIFNnddAIKQKIVTMIGYSQLLTIMFARVDKNKIQANES 1573 Atta cephalotes
KYQ60250      493 RLDILHGFLLPAFKFCDSAAIESFFDYNYKVLYDYYIDFLNISNd-dAIKQKIVTMIGYSQLLTIMFARVDKNKIQANQT 571  Trachymyrmex ...
XP_002110143 1748 RRAAIERVCLPMLQKASLKITKDFYVSHIKEIMDIIEAKLVKTAd---LENQLISKLGSYKLMKLMYSKLSKQDVNTAES 1824 Trichoplax ad...
KOF80019      349 EVNFVYCKAQ--NIEaqkivGKELTKVITRIAHQTKKE--DMRGETLYLELHRQVHCAAYNLLIAIISCTQTDLKFYNVF 424  Octopus bimac...
EKC33407     1766 VINKKFCEVKsvNVDt----GKEMTQVIMRTAHEAKGE--DVRGETSCVELRRQYHCAAYNLLIAVLSSTQTDAKFYTAF 1839 Pacific oyster
XP_009052558 1706 VINEKYCQTK--VET-----GKEMTQKATKCAHEARSE--DTRGETELVELRRQYHCTAYNLMISIISCTQTEAKFYNCF 1776 owl limpet
EDO34281      285 SINLAYCPND--NT------GKELTKAITKSAHAAKSE--DMRGETVAFELRRQLHCAAYNALLALISCTQTELKFYTAF 354  starlet sea a...
XP_004996596 1774 VINKTYCEAAgePVNd---kGSNLTTN---TCRALR-D--TVTGEESLVELRRQASCAAYNALTTVICKTQTQEKFYSAF 1844 Salpingoeca r...
XP_001848795 1039 PVAKTLYGEG--KTP-----GNKMITDFTKKAYAARSEv-FLTPDSPTAELFRKYQCAAYRTLAAIISNTKDDLQLYNVL 1110 southern hous...
KMQ98034     1675 TIARNALHQ---IEN-----DRQLLQNLFKRARDMRAL--RIT-QSGCNELTRLLHCSAYNCSLAIINLNEKE-KTY-GA 1741 Lasius niger
XP_012056011 1574 TMQNPGSNLK--ILIk----RNDYQQ-LVKSTIKIFQK--SIKW-SVHQEFIHQLQCSLYNCLLAIISLKEDE-IFYRVV 1642 Atta cephalotes
KYQ60250      572 TIQNPGSNTS--ILV-----KRNDYQQLGQITKKMQMKirKFRW-SVCQKLVRQLQCSLYNCLLAIISLKEDE--YCYRI 641  Trachymyrmex ...
XP_002110143 1825 SIVKAYTGRP--TED-----GKEITKSITKAAHACKSD--DLRGETRSVELHRQCCCAAYNALISVISSTQTEMKFYTVF 1895 Trichoplax ad...
KOF80019      425 LFAENEEKKEFLLDNVIDK--EKKY-SFPIVFE-MQPKKETIFLTLQK-EIK----QKVVADASQSASY-HLSSVYLEKS 494  Octopus bimac...
EKC33407     1840 LFKEDEAKGQFVFDNLLDK--DKAY-VFSSELK-APLSRKKQYVSIRN-EVKesnsQNGEADEGESSSL-HLASQYLADS 1913 Pacific oyster
XP_009052558 1777 LFSEKPSKGQFLLDNILDC--EKMF-EFKAELD-SPLERKKRFVSIRN-EVKe--tRQGEEEESLFSSY-NISTQNIEES 1848 owl limpet
EDO34281      355 LFNENPVKGQFLLDNLIDT--DRKY-EFEVELS-TPLERKKQMTSIRI-NARvq-sDQVEEALSQGRSVrYLSSQYLADS 428  starlet sea a...
XP_004996596 1845 CFKEATGKVRDCVFNLIDE--KRKY-TFTTELPaAMSVRSKCVLALREgEATp--sTTAAATA---AARrYLPSQILADS 1916 Salpingoeca r...
XP_001848795 1111 LFRENGDKNEFIWRKLINCseNHLYdGFGQELE-EYPKIKDKLVSIRR---------LTAVSASNSKRFkYIQMTSVFES 1180 southern hous...
KMQ98034     1742 VFGENSAEDLLIWKNIVDL--DKRY-QLGQTFK-EHPKTREIAVNIRS--------TTFSMDGSR-HRYaYVHSYDLSAS 1808 Lasius niger
XP_012056011 1643 F-------DTFGWEKIVDC--RTQY-TFGQSVK-DYPKTREITVNIRS--------AEIEREE-QTHRYtYIHSYDLSSC 1702 Atta cephalotes
KYQ60250      642 VFSE-----PYVWEDIIDC--RTQY-ELDQIFK-EYPKTHEITVNIRS--------AEVESEERQTHRYtYVHSYDLSAC 704  Trachymyrmex ...
XP_002110143 1896 LFTENVARKQLLWENLIDM--EREY-AFEIELS-YQDKQKTTFRSLRE---------QSRSSVSMAPSY-HLPSQYLADS 1961 Trichoplax ad...
KOF80019      495 SLSVDIGRY-DYLSSNve------hQEIPSISEEEN----------SANSSAISEEKTRGY---------ALEMDEINQS 548  Octopus bimac...
EKC33407     1914 SLHEDLNQY-DFTATPqm------sEGSPREKVLTV----------RKSSYTDEEDDTDTKvmve-ddyvELEMDELNQH 1975 Pacific oyster
XP_009052558 1849 SLSDDLNQY-DFNSGTa--------QVFFSDIFSDL----------TSSSNVQPDQFNTTVdy------iELELDELNQH 1903 owl limpet
EDO34281      429 SLSEEVSQF-DFSTPV------------------QV----------NIINYLKRTGKPDQLgedsyeigeDVEMDELNSH 479  starlet sea a...
XP_004996596 1917 SLSQDAAQLeALRQGAdvgesqaveDASSSSSSPPSsdgptfgldmDASEDSPGAPSNIPVyvv---edsQMEMDELNSH 1993 Salpingoeca r...
XP_001848795 1181 SLSQDVTKL-DLNYSVv--------RTTQEASTVQA------------DEFSQQLARKTTI---------ALERSKVNDH 1230 southern hous...
KMQ98034     1809 TLCEDINAY-DFNRSV----------LLPFNRHHPA-----------SARNLGDSHGATSV---------VLENDDFNEH 1857 Lasius niger
XP_012056011 1703 TLSEDINAY-DLNKCVvl------pADFRRSTPIMN----------SADSDSLHTHHATSI---------TLTNNDFDKH 1756 Atta cephalotes
KYQ60250      705 TLSEDINAY-DLNKCVvl------pADFHRSASTMN----------SADSDPLRTHNATSI---------TLTSNDFDKH 758  Trachymyrmex ...
XP_002110143 1962 SLNEEISQF-DFNSSTv--------QGYSENNSIKQ-------------IPTRETGDSEKFad------eELELDDLNKH 2013 Trichoplax ad...
KOF80019      549 ECMLPVVAVLKHMYQQNITPKEN----------AEMPPWMYYLHKKFTASSTHLNIKLFIAKLIVNT-AEIFEKYASFWV 617  Octopus bimac...
EKC33407     1976 EGMANMIALLKHMQRAKIIPLVEsg------vvPELPAWMKNLNDKLRSPRTHNNIKYFITKLIINT-AEIFRPYARDWI 2048 Pacific oyster
XP_009052558 1904 ECMATMVALIKHLHTV-ITPVLKgt------ipKEMPTWMSYFSEKMTNPATSFNIKLFIARLIFNT-SEVFQPYTKFWL 1975 owl limpet
EDO34281      480 ECLTKICSLLTHMKESNISPQPDkga-----lpKDMPSWMSALHKKLTNFETHLNIQLFIAKVIINQ-SQVFEPYARFWL 553  starlet sea a...
XP_004996596 1994 ESMVSLMGLIQRIQAVHAESKPQrnedglilpsSTMPSWMSNLLKSFESTSTSHNVRLFIAKLITNM-PDAFQPWSSRWL 2072 Salpingoeca r...
XP_001848795 1231 EVMATICAVIQHMHENKITPTPEgd-------rVVPPPWIKFLAASLRDQQQHKNVRLFLAKVIDNC-RTWLKPYAATLI 1302 southern hous...
KMQ98034     1858 ECMPYICVLLRRIREICVs-------------sNELPECMKLFCNAMPN---HPNITLFLLRIVWNTaDDVFKPYAKFML 1921 Lasius niger
XP_012056011 1757 ECMPYICVLLRHIRKIFGSTN------------TEIPKWLEYFLNTIQHNNLHANIQLFMLKIISNTaDEVFKPYARFAL 1824 Atta cephalotes
KYQ60250      759 ECMPYICVILRHIRKVFVSTNTE-------------PKWLTCFLNAMQRDNLHANIQLFMLKIISNTaDEVFKPYAKFAL 825  Trachymyrmex ...
XP_002110143 2014 ECMEALLTLLDHMAVNKINPAIEkdt-----tpSEMPSWMVALRKKASDHTTNRNIKLFIAKLIINR-PKIFRPYAKFWL 2087 Trichoplax ad...
KOF80019      618 LPLSEFII--CGNFEe--kGINYFVLDIIVMILSWGENSIP 654  Octopus bimaculoides
EKC33407     2049 RPLTQLII--SGLFT----GLNYFVIDVIVTIMSWHQVAIP 2083 Pacific oyster
XP_009052558 1976 RPLCQLIF--SGPLSs--dGINYFNVDLIVMMMSWHTTSIP 2012 owl limpet
EDO34281      554 SPLMELILklIEEEGenkrGLNYFVVDLLVTILSWATTAIP 594  starlet sea anemone
XP_004996596 2073 RPIMLLIL--KFQDEpetpGFNYFVTDLCLLLLTWADTAVP 2111 Salpingoeca rosetta
XP_001848795 1303 PPLMQVIV--DECITt---qLNTFVTDLYALILEWSDAFQP 1338 southern house mosquito
KMQ98034     1922 TPIVKTVA--NYLERy---dLNYIITDILEILMDWHDVAVP 1957 Lasius niger
XP_012056011 1825 TKIIKTIA--NYLQGn--nNLNYIITDVLEILMNWHDIAIP 1861 Atta cephalotes
KYQ60250      826 TRIIKTIA--NYLQGn---NLNYIITDILEILMDWHNVAIP 861  Trachymyrmex zeteki
XP_002110143 2088 VPLIQLII--EGKESd---GIHYFIVDLMIVLLSWADVAIP 2123 Trichoplax adhaerens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap