Conserved Protein Domain Family
NUC129

?
pfam08157: NUC129 
NUC129 domain
This C terminal domain is found in a novel family of hypothetical nucleolar proteins.
Statistics
?
PSSM-Id: 400465
View PSSM: pfam08157
Aligned: 15 rows
Threshold Bit Score: 104.762
Threshold Setting Gi: 1343921808
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_005041637  83 YMAVCLKDHSVTGLHQQLAKDFLNAQLYGPHTNRVQANEFFSLANKKAPVKKAAVQFVDKSWG 145 Collared flycatcher
XP_687281    157 YTVMRLKDESASNSLQQSAVDFIQSRFYGPRTNRTTNTELLSLNKKRGVNKGAAVQFANKKWA 219 zebrafish
XP_006634436 156 YKVQRVKDHSLAKAQQTSACDFITSRLYGSGSNRTTTNQLLSLQNKTAKNKRAAVQFIDKQWd 218 spotted gar
XP_003459134 144 YTVTTVKERTLASFQQQVAEEFIRSRLYGPGTCRTTSNEMLSLQNKKGWNKSAAVQFVKKDWA 206 Nile tilapia
2_pfamImport   1 YTVTTVKQSTLASSQLKAAEDFLHSRMYGPGSRRTTSNEMLSLENKMGKNKSAAVQFVKKNWA 63 
XP_004078798 141 YTVTTMKGGAAVSFQQKSAEDFLQSRLYGPGRLRTTNNQMLSLQNKRGSQKSAAVQFVKKDWA 203 Japanese medaka
XP_007487988 165 YMACRLKDQDLIDLRQQAAKGFLQKYLYGRGSNRTTVNKFLSLNNKRLLVKKPAVQFVNNSWG 227 gray short-tailed opossum
Q3SZ46       171 YMAVRLKDQDLRDSRQEAAKAFIQNCLYGPGTNRTTVNKFLSLENKRLPMKKAAAQFLNNTWG 233 cattle
Q9D7Z3       167 YMAVRLKDEDLRDSRQEAAKHFIHSCLYGSDSKRTTVNKFLSLNNKRSPVKKAAAQFLTSTWG 229 house mouse
XP_008260626 390 YVALRLKDQELRDSRQQAARAFIHESLYGPGTNRTSVNKFLSLDNKRLPVKKAAAQFLNSAWG 452 rabbit
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap