4WZW


Conserved Protein Domain Family
CPL

?
pfam08144: CPL 
CPL (NUC119) domain
This C terminal domain is fund in Penguin-like proteins associated with Pumilio like repeats.
Statistics
?
PSSM-Id: 400452
View PSSM: pfam08144
Aligned: 59 rows
Threshold Bit Score: 121.965
Threshold Setting Gi: 146448067
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4WZW_A       307 NDKYGRKVLLYLLSPRDPAHTVREIIEVLQKGDGNAHSKKDTEVRRRELLESISPALLSYLQEHAQEVVLDKSACVLVSD 386
2_pfamImport   1 ENKFGRKVLIYLMSPRNPSHFLPEIVKLLSTGDSNATSKKPMAQRHQELSEGASPRILEYLAENITPIIYDRSMFVLLQV 80 
XP_018669617 381 LNKYGRKVLIYLMSPRNTSHFLPEVVKMLSTGDSNSTSKKPLEQRHSELSEAASPGILKYLADNLEQIIYDRSTFVLVQV 460 vase tunicate
XP_788454    470 TDQYGRKVLLYLLVPRDPSHFHPDIVKQLQRGDDNPVSKKESAVRRKELLEAASPALLKLLITHTKEMAYSKSNSQLALA 549 purple sea urchin
XP_008101536 415 NNKYGRKVLLYLLSPRDSTYFSPAIIKILQQGDGNAYSKKDVDVRHRELLEAISPALLNYLHLHAEEMVMDKAAFIVVTG 494 green anole
XP_015195694 434 NNKYGKKVLLYLLSPRDPAHFLPEIIQVLEKGDGNAHSKKDVETRRRELLEAISPPLLQYLCENTREMVMDKASSVLVTD 513 spotted gar
X1WGX5       417 SNKHGKKVLLYLLSPRDPAHLLPEIIQVLEKGDGNAHSKKDVLIRRKELLEAASPSLLNHLCENAQSMVMDKSCCVVVSD 496 zebrafish
XP_004075191 431 SNKHGKKVLLYLLSHRNPAHLLPEIIKVLEQGDGNAHSKKDPEKRRKELLEALSPPILDYLCENAADMVKDKATGVIISD 510 Japanese medaka
CAG00964     365 NNKYGKKVLLYLLSPRDPAHLLPEIIKMLERGDGNAHSKKDTAVRRKELLDAVSPALLEYLCSNARAMVTDKATSVTVSD 444 spotted green p...
XP_005815114 422 GNKHGKKVLLYLLRPRDPTHMLPDIVKLLEQGDGNAHSKKDMATRRRELLEAASPALLDHLQLNTAAMVTNKAASVTVRD 501 southern platyfish
4WZW_A       387 ILGSATGDVQPTMnaIASLAATGlhp-----ggKDGELHIAEHPAGHLVLKWLIEQDKKMKEN 444
2_pfamImport  81 AVLCCTGDTNTLIeaILAQAGSEfspg---atnEDGKMHVIEDPCGHMVMKKLIVAESKRMTE 140
XP_018669617 461 AVLCCHGDNSELIqaIVKEAGKEfvag---eknETGKMHIIEDPCGHLVIKKLIVTESKSAAE 520 vase tunicate
XP_788454    550 LLQHIEGDKSAVYsmLATLAAEElvpilvndpgKMDEMHIVEHPSGHLMFKRLLAHEKAEREK 612 purple sea urchin
XP_008101536 495 ILRHAMGDVQPAMetIANLAAREmvp-----ggKDGQLHIAEHPAGHLVLKWLIEQDEKMKES 552 green anole
XP_015195694 514 ILGAALGDLKPAMdsVAKLAAEEfvp-----ggKEGQLHMAEHPAGHLVLKWLIEQDAKMKET 571 spotted gar
X1WGX5       497 ILGSAVGDLRPAMeaVAALADGPlip-----ggKDGQLHMAEHPAGHLVLKWLIEQDTKMKDT 554 zebrafish
XP_004075191 511 ILGSACGDLRPAMtaVAQLANQElvp-----ggVDGELHMAEHPAGHLVLKWLIQKDGELAQA 568 Japanese medaka
CAG00964     445 ILASACGDLRPAMtaVAQLANQEfvp-----ggTDGQLHMAEHPAGHLVLKWLIEQDVTLAEA 502 spotted green pufferfish
XP_005815114 502 ILASACGDLRPAMtaVAQLANQElvq-----ggVEGQLHLAEHPAGHLVLKWLIEQDAMLAEN 559 southern platyfish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap