1D6B,1B8W


Conserved Protein Domain Family
Defensin_3

?
pfam08131: Defensin_3 
Click on image for an interactive view with Cn3D
Defensin-like peptide family
This family consists of the defensin-like peptides (DLPs) isolated from platypus venom. These DLPs show similar three-dimensional fold to that of beta-defensin-12 and sodium-channel neurotoxin Shl. However the side chains known to be functionally important to beta-defensin-12 and Shl are not conserved in DLPs. This suggests a different biological function. Consistent with this contention, DLPs have been shown to possess no anti-microbial properties and have no observable activity on rat dorsal-root-ganglion sodium-channel currents.
Statistics
?
PSSM-Id: 400446
View PSSM: pfam08131
Aligned: 2 rows
Threshold Bit Score: 57.3199
Threshold Setting Gi: 159162099
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1D6B_A  4 FEMQACWSHSGVCRDKSERNCKPMAWTYCENRNQKCCEY 42  platypus
1B8W_A  4 HRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK 42  platypus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap