1U2Z


Conserved Protein Domain Family
DOT1

?
pfam08123: DOT1 
Click on image for an interactive view with Cn3D
Histone methylation protein DOT1
The DOT1 domain regulates gene expression by methylating histone H3. H3 methylation by DOT1 has been shown to be required for the DNA damage checkpoint in yeast.
Statistics
?
PSSM-Id: 149273
View PSSM: pfam08123
Aligned: 11 rows
Threshold Bit Score: 299.602
Threshold Setting Gi: 218512011
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1U2Z_B  201 YTRSIHPQANKLK-HYKAFSNYVYGELLPNFLSDVYQQCQLKKGDTFMDLGSGVGNCVVQAALECGCALSFGCEIMDDAS 279  baker's yeast
Q6BTC8  959 YSRIVSTESRKLR-SYKAFTAEVYGELLPSFTSEVLTKVNLQPQHKFYDLGSGVGNTTFQAALEFGVHLSGGCEIMEHAS 1037 Debaryomyces hansen...
Q6C4Y5  275 YSRIVSPESKSLR-DYKAFSNNVYGELMPPFMSTVFQKTDLQPSSVFVDLGSGVGNCTLQAALEVGCE-SWGCEVMTNAS 352  Yarrowia lipolytica...
Q7SB74  330 YDRTVAPRVELLA-KYQNGSDNVYGELNHPFISDILERTNLTSDKVFVDLGSGVGNVTLQAALEIGCE-SWGCEMMENAC 407  Neurospora crassa O...
Q8INR6  121 YNAAV-LDPDKLN-QYEPFSPEVYGETSYELVQQMLKHVTVSKEDTFIDLGSGVGQVVLQMAGSFPLKTCIGIEKADTPA 198  fruit fly
Q6XZL8  115 YNHSV-TDPEKLN-NYEPFSPEVYGETSFDLVAQMIDEIKMTEDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPA 192  house mouse
Q23200  148 YRFSV-PDANVLR-HYAVGTSTVYGELHCSQMASFVDQLNMGPSDYFMDLGSGIGHLVNFVAAYARTQMSVGVELMDNLA 225  Caenorhabditis elegans
Q6AW06  151 YECAV-PRPADLNqHYKSFTSETYGETNPEQLISIIDELNIGPQDVFVDLGSGIGQLVCLTAAYAKCKKSVGIELSQVPS 229  Caenorhabditis elegans
Q6CWV1  339 YTRAIYPHARKLK-KYTSFSNFVYGELMPDFLTIVFKKCGLNSNSIFMDLGSGVGNCVIQASLEFGCKLSFGCEIMDSAS 417  Kluyveromyces lacti...
Q6FNM5  420 YTRSIHPYASKLK-QYKAFSNYVYGELLPGFLTDVYSKCGLSKNHLFMDLGSGVGNCVIQASLEFGCRESFGCEIMEAAS 498  [Candida] glabrata ...
Q756E1  342 YSRCVLPNVNGLK-EYRSFSNFVYGELLPTFLSTVYQQCDLKPGQIFIDLGSGVGNCVVQASLEYGCALSFGCEIMKNAS 420  Eremothecium gossyp...
1U2Z_B  280 DLTILQYEELKKRCKLYGMRLNNVEFSlKKSFVDNNRVAELIPQCDVILVNNFLFDEDLNKKV-EKILQTAKVGCKIISL 358  baker's yeast
Q6BTC8 1038 KLTELQTMLLNKHLALLGLKKLPLNFAlSQSFVENDIVRQAVIECDVLLVNNYLFDVNLNTAV-GKMLYGLKPGTKIISL 1116 Debaryomyces hansen...
Q6C4Y5  353 SLAEKQKIELYSRAKMFGIKTGDIHLV-ASSFVHNDEVHSAISRADVLLVNNYAFDGTLNAHL-LDMFLDLKEGCKIVSL 430  Yarrowia lipolytica...
Q7SB74  408 NLAEAQYDEFLARCRLWGVKPGKVRLE-RGDFRKNEKILEVLKRADVVLVNNQAFTSQLNDNL-VSMFLDLKIGCKIISL 485  Neurospora crassa O...
Q8INR6  199 RYAERMDVIFRQYMGWFGKRFCEYKLI-KGDFLVDEHRENI-TSSTLVFVNNFAFGPTVDHQL-KERFADLRDGARVVSS 275  fruit fly
Q6XZL8  193 KYAETMDREFRKWMKWYGKKHAEYTLE-RGDFLSEEWRERI-ANTSVIFVNNFAFGPEVDHQL-KERFANMKEGGRIVSS 269  house mouse
Q23200  226 EIAEKNKEFNERLLNHFGKKVYATRFI-HGSFTSPAVIREIQTKATVILANNVRFDPELKLQL-KEILMGCKDRTRIISS 303  Caenorhabditis elegans
Q6AW06  230 NFAQDLAGYFKKFMSHFGKNHGKFEHI-QGDFLNPKFKQLICEEATVIFINNFAFDAALMLRInTELLQDLKHGTRIVTT 308  Caenorhabditis elegans
Q6CWV1  418 DMAELQLKELKSRCDLWGINLPPIDFSlRKSFVDNERVRELIPQCDVILINNFIFDAPLNKEV-EKVVQGLKAGSKIISL 496  Kluyveromyces lacti...
Q6FNM5  499 ELTEIQMREYSNRCKLFGFKQSKIDYSlRKSFINNEKVESLIPECDVLLVNNFLFDGKLNYEV-TKLLQKTKVGCKIISL 577  [Candida] glabrata ...
Q756E1  421 ALAKSQLKELEERCALWGVDLKPIEFSlRKSFIDNERVNELLPQCDVLLINNFIFDTKLNQAV-EKLIQGLKPGCKIITL 499  Eremothecium gossyp...
1U2Z_B  359 KSLRSLTYQi-nFYNVENIFNRLKVQRYDLKED-SVSWTHSG-GEYYISTV 406  baker's yeast
Q6BTC8 1117 RNFIRPRYK---ASSDKTIFDYLKVERHEMSNYlSVSWTANK-VPYYISTV 1163 Debaryomyces hansenii CBS767
Q6C4Y5  431 KSFVPVGHVi-sEHNIESPVNILKVQKLDFYSG-SVSWTAAG-GTYYISTV 478  Yarrowia lipolytica CLIB122
Q7SB74  486 KTFVHDNKN----AENDVATSILDVEHLTYPEG-YVSWTGAS-GTYCISTR 530  Neurospora crassa OR74A
Q8INR6  276 KSFCPLNFRi-tDRNLSDIGTIMHVSEIPPLKG-SVSWTCKP-VSYYLHVI 323  fruit fly
Q6XZL8  270 KPFAPLNFRi-nSRNLSDIGTIMRVVELSPLKG-SVSWTGKP-VSYYLHTI 317  house mouse
Q23200  304 EPLVPSRARqtnSRRADDFVKISDESLLNLVDN-NVSWTSRK-VPFYLTTI 352  Caenorhabditis elegans
Q6AW06  309 KELGTNKKEi-tFRSTSDINAISHTTELKTTES-AVSWTSSH-VKFWLTTI 356  Caenorhabditis elegans
Q6CWV1  497 KSIRPPGYSi-nYDDMDNIFNRLHVESFKLPEN-SVSWTYRSvGDYYISTV 545  Kluyveromyces lactis NRRL Y-1140
Q6FNM5  578 KNIRASGYTl-dTVNIESVLNRLEVKKYRLDNN-SVSWTHNG-GEYFISTV 625  [Candida] glabrata CBS 138
Q756E1  500 KNLRPSGYTi-nFDDVENILNRLKVEKFTLPED-SVSWTYRGgGEYFISTV 548  Eremothecium gossypii ATCC 10895
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap