Conserved Protein Domain Family
MDM31_MDM32

?
pfam08118: MDM31_MDM32 
Yeast mitochondrial distribution and morphology (MDM) proteins
Proteins in this family are yeast mitochondrial inner membrane proteins MDM31 and MDM32. These proteins are required for the maintenance of mitochondrial morphology, and the stability of mitochondrial DNA.
Statistics
?
PSSM-Id: 400442
View PSSM: pfam08118
Aligned: 70 rows
Threshold Bit Score: 502.845
Threshold Setting Gi: 68473149
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_011109321        254 KEELLAAASNAWDRLRIRFKWLTIRQIRPFNMDEI-SAFFSWIILGNLAWIILGTTTFFSIGIWLVNTV------FAQ-- 324 Dactylel...
XP_719380            88 KATLLSQANSGLSRMLIHLKWPLSRNTNTTSTWDMtSAFISWLVMGNILWIILGTTTFGLTLMYSLHYLdslvgkFSDdk 167 Candida ...
ESK93861            150 RDDFLRLADGFWQGLRIRFKWFTIRSFRKFNADDI-SGIVTWILMSQTIWILIGTTTFFSVVFAIANSL------RLQ-- 220 Moniliop...
EKM80591             11 RDEFLSVATGFWQRLNIRFKWFTIKSFRKFNADDI-SAFVTWFLMSQTLWIFVGTTTFFSVIFAVANSL------RLQ-- 81  Agaricus...
WGS:AACS:CC1G_04498 186 REDFLNVATSFWQRLRIRFKWFTIKSFRKFNADDI-SAFITWFLMSQTLWILVGTTTFFSVIFAIANSL------QLQ-- 256 Coprinop...
EGN99928             70 RDDFLRVATGFWQRLRIRFKWFTIRSFRRFNADDI-SAFITWFLMSQTLWILVGTTTFFSVVFATANSL------RLQ-- 140 Serpula ...
EKM54190            127 RDDFLNAASGFWQRMRVRFKWLTIRSFRKYNADEI-SAFITWFFMSQTLWLFVGTTTFFSVFLITVNSL------RLQ-- 197 Phaneroc...
EMD37322             11 RDDFLKAANGFWQRARVRFKWLTIRSFRKYNADEI-SAFITWFLMSQTLWLFVGTTTFFSVLFATANSL------RLQ-- 81  Gelatopo...
EPT04549            112 REDFLNAANGFWQRARVRFRWLTIRSFRKYNADDI-SAFVTWFVMSQTLWLFIGTTTFFSVIFATINSL------RLQ-- 182 Fomitops...
CCA69884            141 KDEMLALANGFWERLRIRFKWFTIRGFRKFNTDDM-SAFLSWIVFGQAVWILLGTTTFFSVVFATFNSL------RMQ-- 211 Serendip...
XP_011109321        325 ---------------EHLAKVVGNYLTQEMGMKVVFES-AIVPRWKDGCISFKNVFISRR-PG---IlKGAGiekgSSSV 384 Dactylel...
XP_719380           168 ettdklnqtksktstNVMSYLIGGIISFGIGVDLNFEKgSSLPELKDGKLRFKNVGIVSH-------------------- 227 Candida ...
ESK93861            221 ---------------NFIARGISDYLTSETGVTVIFES-AIVPKWKDSRISFKNVYISRR-PV-------------SMQT 270 Moniliop...
EKM80591             82 ---------------HYIARAISDYLTSETGVIIIFES-AIVPKWRESRISFKNVYVSRRlPEt------------AARK 133 Agaricus...
WGS:AACS:CC1G_04498 257 ---------------HYIARAISDYLTSETGVTIIFES-AIVPKWKDSRISFKNVYVSRR-PAdsdIgSP------LGTP 313 Coprinop...
EGN99928            141 ---------------ENVARAISNYLTAETGVTIIFES-AIVPKWKDSRISFKNVYISRR-PRs-----------dVTPS 192 Serpula ...
EKM54190            198 ---------------ENVARAISDYLTAETGIHIVFES-AIVPKWKDSRISFKNVYITRR-PDv------------VNKV 248 Phaneroc...
EMD37322             82 ---------------EYVARAISDYLTSETGITIIFES-AIVPKWKDSHISFKNVFVSRR-PLdleT---------VRQR 135 Gelatopo...
EPT04549            183 ---------------EYVARAISDYLTSETGITIIFES-AIVPKWKDSRISFKNVYVIRG-PKgpeMa--------RARS 237 Fomitops...
CCA69884            212 ---------------EFVARKISDYLTRETGWTVVFES-AIVPKWKDGKISFKKTYISRH-PDltsHlSQDA----PKSP 270 Serendip...
XP_011109321        385 AAAAAAAAAFS-ESHSG----------TADE----------------EDDGNYTQFDLTVDTVNVTISLAKWMNGRGLLV 437 Dactylel...
XP_719380           228 -----------------------------------------------DGNNKHVKFKGTVEAMDITLSFNKWYEGNGLIY 260 Candida ...
ESK93861            271 QQKKLKEHQSAlGYDVAhhpayhhiedDDDElpf-----------ppEEECNYSMFDLNIGSIDVTLSLWRWLDGKGLIE 339 Moniliop...
EKM80591            134 IQRKRSEHLTAaGYDVSnhpgyhqlneDDDEdavp--------ieldKQDTNMSLFDLNIDSVDVTLSLWRWLDGKGLVE 205 Agaricus...
WGS:AACS:CC1G_04498 314 PNEERSRNMAGvGYDVGnhpayhrvgeEDEDnadgf-------rpleDEDYNYTMFDLTIDSVDVTLSLWRWLDGKGLVE 386 Coprinop...
EGN99928            193 TEKKVTGHKAAiGYDVSghpayhytgdEEEEitl----------dhsDDDLNYSMFDLNVDSIDVTLSFKRWLDGKGLVE 262 Serpula ...
EKM54190            249 RADRNTGYHYAtGYDVSnhpanhgfmyDEEDsile---------elpGEDTNYSMFDLSVDTIDVTLSFTRWLEGKGLVT 319 Phaneroc...
EMD37322            136 RSLRNAGYKAAvGYDVSnhpsnhslaeEDDDmmle---------dhsNDDVNYSMFDLSVDSIDVTLSFTRWWQGKGLVT 206 Gelatopo...
EPT04549            238 DAMFHAGHKVAvGYDVSnhpsfhsigeEEDDdgpn---------aphDEDLNYTMFDLTVDSIDVTLSFARWWQGKGLVV 308 Fomitops...
CCA69884            271 DSASHPAHTAAtRLDVhhpti-hhsgeDDIEhfvaprtleiesidelTPDQRITTFDLEVDSVDVELSLSRWLDGKGLVQ 349 Serendip...
XP_011109321        438 DVDMKGVRGVVDRTHLRFDP--DVDPRSYRH---KHAPGDFE-------------------LDHFKLEDLLVTVYQTGGF 493 Dactylel...
XP_719380           261 DLELYGLNGKLYKSRSPSPPvaNTTKKSYRFnenIHYQYDLDhnveeiasgsssiidnnytFDHVKIHDSYLEIYEEQSS 340 Candida ...
ESK93861            340 SAAVKGVRGVLDRRSVRYDPdhPLDPALFRH---ESHPGDFE-------------------LESLQLEDVLITVHQPGGF 397 Moniliop...
EKM80591            206 DAVVKGVRGVLDRTNVYWDPdnPLDPALFRH---KFVPGDFE-------------------LESMQLEDLLITVYQPGSF 263 Agaricus...
WGS:AACS:CC1G_04498 387 DAVIKGVRGVVDRRNVFWDPdnPLDPAAFRH---KYQPGDFE-------------------LERLQLEDVLVTVYQPGEF 444 Coprinop...
EGN99928            263 DAVIKGVRGILDRRSVFWDPehPLDPAAFRH---TPQPGDFE-------------------LELLQLEDVLITVYQPGDF 320 Serpula ...
EKM54190            320 DAVVKGVRGVLDRRFVHWDPenPLDPASFRH---QARQGDFE-------------------LESFQLEDLLVTVYQPGSF 377 Phaneroc...
EMD37322            207 DAVIKGVRGVLDRRSVTWDPdhPLDPAAFRH---IAQPGDFE-------------------LESLRLEDVLITVYQPGGF 264 Gelatopo...
EPT04549            309 DAVVKGVRGVLDRRNVFWDPdhPLDPVLFRH---ESQPGDFE-------------------LESLQIEDLLLTVYQPGGF 366 Fomitops...
CCA69884            350 NATIKGVRGVVDRRLISMDTd-DLDPASFRH----PNPG-FE-------------------LESLQLEDVLVTVYQP-NF 403 Serendip...
XP_011109321        494 RPFHVSIFSCDLPQLRKRWLFYDFLSANHVSGSYDDSLFTLHPRQThgPVNPVSGQIDAQegaiyPWKKTSRFRIDGLRF 573 Dactylel...
XP_719380           341 TPIKINIFSCDLPKLRGDKLVLDFFNANNASGAINDAMFTLHKRQN--LDPENK-----------NQDKLIRFKLDAIDL 407 Candida ...
ESK93861            398 RPYTASIFRADIRTFRKRWLFYDFLCAENIVGQFDNCLFSLHKPQS--IGRTTEMDLQDG-----EWARMSRIRIDGVNI 470 Moniliop...
EKM80591            264 RPFTASIFRADIQQFRKRWLFYDFLCAENVVGQFDNCLFSLHTPQS--IGRTTEKDLEDG-----EWARMSRLRIDGVNI 336 Agaricus...
WGS:AACS:CC1G_04498 445 RPYTASIFRADIRTFRKRWLFYDFLAAENVVGQFDNCLFSLHKPQS--IGRTTEKDLEHG-----DWGMMTRIRIDGVNI 517 Coprinop...
EGN99928            321 RPYTASIFRADMRNLRKQWLFYDFLCAENVVGQFDNCLFSLHKPQS--IGRTTDQDLKDG-----KWSRMSRIRIDGVNI 393 Serpula ...
EKM54190            378 RPFTASIFRADIRTFRKQWLFYDFLSAENVVGQFDNCLFSLHKPQS--IGRTTEQDLKDG-----QWARMSRLRIDGVNI 450 Phaneroc...
EMD37322            265 RPYTASIFRADIRTFRKQWLFYDFLRAENVVGQFDNCLFSLHRPQS--IGRTTDQDLKDG-----QWARMSRFRMDGLNV 337 Gelatopo...
EPT04549            367 RPFTASIFRADMRTFRKQWPFYDFLAAENVVGQYDNCLFSLHRPQS--IGRTTEQDLQDG-----KWARMSRFRMDGLNV 439 Fomitops...
CCA69884            404 RPYMASIFQADFRLLRKQWLFYDLLSAKSIVGQFDNCLFSLHEPQS--IGRTMAEDLKDT-----QWKRMSRFRIDGVNI 476 Serendip...
XP_011109321        574 DHLN---RGYEGPLSWIVSGNLDIIADIHFPE-DS-AE-GISKFMHDMMEKMETSITARReklTDmisgtdglsyenisg 647 Dactylel...
XP_719380           408 GEINk--YDPNSKFNWIINGKAEVIADITLPE----EQdDLNESITEVLTKMFTNMFQTA---DMsqt------------ 466 Candida ...
ESK93861            471 DHLQa-sTTMEGPVSWITSGKLDAVFDIKFPQ-DP-GDgTLSAILEEITDAITTTVLSNT---PDpilqr---------- 534 Moniliop...
EKM80591            337 DHLQnstTTMEGPISWITSGKVDAVLDIKFPR-DPnGDlHLNAILGEIADAITTSISSNM---NEqeshper-------- 404 Agaricus...
WGS:AACS:CC1G_04498 518 DHLQn-sTTMEGPISWITSGKVDAVLDIKFPR-DPqDGlALNAILEEIADAITTSLTNSQ---ETedtrr---------- 582 Coprinop...
EGN99928            394 DHMQn-sTTQEGPISWITSGKVDAVLDIKFPR-DPeDDfPLNALLGEIADALSTAASVSL---LNerip----------- 457 Serpula ...
EKM54190            451 DHLQh-mSTQEGPISWITSGKVDAVLDIKFPR-DYsDDsPFNTLIGEIADAITTAATSAV---AErip------------ 513 Phaneroc...
EMD37322            338 DHLQa-mTTQEGPISWITSGKVDAVLDIKFPReDPeEG--FEALLGELADAISTAASSVA---LDrip------------ 399 Gelatopo...
EPT04549            440 DHMQa-mTTQDGPFSWITSGKVDAVLDIKFPR-GPtDElQINALLGELADAISTAASSVA---ASaeri----------- 503 Fomitops...
CCA69884            477 DHLQaatGSSAGPISWITSGKVDAVLDIKFPR-DAsGEvDISSLINEIAHNISVATSSGE---STptdvamrhms----- 547 Serendip...
XP_011109321        648 iigaavgltegdgavanamaleddgnyttailhddlfddlgntlRSTNMADTSVVSKPTTASIQMDQAS--DNQKFMMID 725 Dactylel...
XP_719380           467 -----------------------------------------sedSLLKDAISAIYHTFRKPEETAKP----AENSYVMVN 501 Candida ...
ESK93861            535 ---------------------------------------ipgqrELAKPPLSAPESE-------DAADRvgNTEPKVVID 568 Moniliop...
EKM80591            405 -------------------------------------kripgqrELARPPLSAPDDNMYEGTGANSGEE--EEELKIIVD 445 Agaricus...
WGS:AACS:CC1G_04498 583 ---------------------------------------ipgnrELAKPPISPPSLELLE----SVAKE--DEKRKVVVD 617 Coprinop...
EGN99928            458 -----------------------------------------gqrELAKPPLTAPQSD-------DFTED--DDTPKVIID 487 Serpula ...
EKM54190            514 -----------------------------------------gqrELAKPPLSAPSDQTAMPADS-------AEHPKIIID 545 Phaneroc...
EMD37322            400 -----------------------------------------gqrELAKPPLSPPSDEEDA----RRPQH--EDKPRLVID 432 Gelatopo...
EPT04549            504 ----------------------------------------pgqsRLAKPPLSAPSDRDST----QLAET--AGEPQVVID 537 Fomitops...
CCA69884            548 -----------------------------------lsdripgqrELAKPALRSPDGELER----EESKTklGVGSEVVID 588 Serendip...
XP_011109321        726 LHLEMNDTRAAIP--LFTQ-D-LSYKNNALMRPIIAYINSQRTIIPINCRMVKRVTEFDGSWTLFDSGLMDDLSSEVYDA 801 Dactylel...
XP_719380           502 VKMKLYDLKASLPqvLPRTnNgIPFISLTDLRSLISFINTENQPITIKSTVIEKITDLSNIQHLGQTKMFDYIMGDAYEE 581 Candida ...
ESK93861            569 IDLRFRDVKAAVP--IFTN-D-LSYVNNALIRPIVAFMNANRTLVPIHCKVVKPLNDFEGAWTMWETGLMDEISLKIYDA 644 Moniliop...
EKM80591            446 MDLRFRDLKAAVP--IFNR-D-LSYVNNAFIRPIVAFMNANRTLVPIHCRIVKKLSDFDGSWTMWESGLMDEISIKTYDA 521 Agaricus...
WGS:AACS:CC1G_04498 618 IDLRFRDLKAAVP--IFTS-D-LSYVNNALIRPIVAFMNANRTLVPIHCRIVKDLSDFDGSWTMWETGLIDEISLNVYEA 693 Coprinop...
EGN99928            488 IDLRFRDLKAAVP--LFAS-D-LSYVNSALIRPIVAFMNAHRTLVPIHCRVTKNLSDFDGAWTMWETGLMDEISEKTYDA 563 Serpula ...
EKM54190            546 IDLRFRDLKTAVP--LFTA-D-LSYANNALIRPIVAFMNANRTLIPIHSRVVKDLSNFDGAWTMWETGLVDDIGAKVYEA 621 Phaneroc...
EMD37322            433 IDLRFRDLKAAVP--IFTN-D-LSYVNNALIRPIVAFMNVHRTLVPIRCHVVKDLSEFDGAWTMWETGLMDSIALKVYEA 508 Gelatopo...
EPT04549            538 IDLRFRDLKAAVP--IFTN-E-LSYTNNALVRPIVAFMNANRTLIPIHCRVVKPLSDFEGSWTLWETGLMDIISLKVYEA 613 Fomitops...
CCA69884            589 IDLRFRDLKAAVP--IFTK-D-LSYANNALVRPIVAFINANRTLIPIHCTVVKELSEFDGSWTAWETGLTDAIALQVYGA 664 Serendip...
XP_011109321        802 FVKDIADADIKKRRIRAVGLWSLQVFMNAFLAAM 835 Dactylellina haptotyla CBS 200.50
XP_719380           582 LTNLVRDD---ARRIINEKSWSNSIATQLLLLGL 612 Candida albicans SC5314
ESK93861            645 LAYHVAQANMNR-RIKTVSVWSLQMTASAVLSAL 677 Moniliophthora roreri MCA 2997
EKM80591            522 LAYHVSQSNMNRQRIRTVSLWSLQMTANAILSAL 555 Agaricus bisporus var. burnettii JB137-S8
WGS:AACS:CC1G_04498 694 MAHHVSQSAMNRQRMKTVSWWSLQMTASAIISAL 727 Coprinopsis cinerea okayama7#130
EGN99928            564 LAHHVAQVNMNR-RVKAVSIWSLQMTASAVLSAL 596 Serpula lacrymans var. lacrymans S7.3
EKM54190            622 MAYHVTQANFNR-RVKAVSAWSLQMTASAILSAL 654 Phanerochaete carnosa HHB-10118-sp
EMD37322            509 MAYHVTQANFNR-RIRAVSSWSLHMTASAILSTL 541 Gelatoporia subvermispora B
EPT04549            614 MAYHVTQANFNR-RLKVVSAWSLQMTASAVISAL 646 Fomitopsis pinicola FP-58527 SS1
CCA69884            665 LAYHVTKMNMNR-RIKAVSSWSLTMASQAVISAL 697 Serendipita indica DSM 11827
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap