Conserved Protein Domain Family

pfam08116: Toxin_29 
PhTx neurotoxin family
This family consists of PhTx insecticidal neurotoxins that are found in the venom of Brazilian, Phoneutria nigriventer. The venom of the Phoneutria nigrivente contains numerous neurotoxic polypeptides of 30-140 amino acids which exert a range of biological effects. While some of these neurotoxins are lethal to mice after intracerebroventricular injections, others are extremely toxic to insects of the orders Diptera and Dictyoptera but had much weaker toxic effects on mice.
PSSM-Id: 149271
Aligned: 4 rows
Threshold Bit Score: 39.8693
Threshold Setting Gi: 50401399
Created: 11-May-2020
Updated: 6-Aug-2020
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
P83894  1 VFCRSNGQQCTSDGQCCYGKCMTAFMGKICM 31  Brazilian armed spider
P84016  1 AFCRFNGQQCTSDGQCCNGRCINAFQGRICI 31  Brazilian Amazonian armed spider
P83915  1 AFCKYNGEQCTSDGQCCNGRCRTAFMGKICM 31  Phoneutria keyserlingi
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap