Conserved Protein Domain Family
Antimicrobial_7

?
pfam08102: Antimicrobial_7 
Scorpion antimicrobial peptide
This family consists of antimicrobial peptides secreted by scorpions. Novel antimicrobial peptides have been isolated from scorpions, namely the opistoporin and the pandinin. These peptides form essentially helical structures and demonstrate high antimicrobial activity against Gram-negative and Gram-positive bacteria respectively.
Statistics
?
PSSM-Id: 116704
Aligned: 4 rows
Threshold Bit Score: 48.06
Created: 23-Mar-2022
Updated: 13-Oct-2022
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q5VJS9  1 GKVWDWIKKTAKDVLNSDVAKQLKNKALNAAKNFVAEKIGATP 43  Opistophthalmus carinatus
P83239  1 GKVWDWIKSAAKKIWSSEPVSQLKGQVLNAAKNYVAEKIGATP 43  emperor scorpion
P83314  1 GKVWDWIKSTAKKLWNSEPVKELKNTALNAAKNFVAEKIGATP 43  Opistophthalmus carinatus
P82656  1 G-ILDTIKSIASKVWNSKTVQDLKRKGI----NWVANKLGVSP 38  Hadrurus aztecus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap