Conserved Protein Domain Family
PROCN

?
pfam08083: PROCN 
PROCN (NUC071) domain
The PROCN domain is the central domain in pre-mRNA splicing factors of PRO8 family.
Statistics
?
PSSM-Id: 400431
View PSSM: pfam08083
Aligned: 15 rows
Threshold Bit Score: 700.68
Threshold Setting Gi: 134073571
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAM72305                  438 GLSLLFAPAPYNSFEGGMKRRIDVPLCDKWYQ-------DPPDllttddrdKILRSYTQLLKHHVKRSLQHTVRQRsssa 510  L...
XP_001330664              381 TLSLFWAPSPFNCRTGNTQRAQDVPLIRPWYTqra--pwKQPV--------KVRVSYQKLLKNYVLNRSHHRKQYVv--- 447  T...
WGS:AAFB:cds.EHI_060350A  344 GLNLINAQYPFNNKYGVTRRAQDVPLIKGWYLehi--qkNYPV--------KVRVSYQKLLKCYVINELQKKPPKS---- 409  E...
EDO41924                  340 GIALLWGPRPFNIRSGRTRRALDIPLVKSWYRehc--psGHPV--------KVRVSYQKLLKCYVLNALKHRPPKA---- 405  s...
EJP67483                  434 AIELWWAPFPFNRRSGRMVRAQDVPLIKQWYLehp-psdRPPV--------KVRVSYQKLLKNYVLNELHKKKPKA---- 500  B...
Q6FQZ4                    478 AFEMYHSPYPFNRRQGHMKRAEDISLVKRAYNerp--gsGEPT--------KVKVSHQKLLKKDVFNALKRNRKN----- 542  [...
XP_003676084              498 AISLFHAPYPFNRTSGRTIRAQDVSLIKKWYLqhp--deEYPV--------KVRVSYQRLLKNYVANELHTVPASN---- 563  N...
XP_016292505              419 AIALWWAPKPYSLRSGRTRRAVDVPLIQPWYLehc--ppNQPV--------KVRVSYQKLLKNYVYNSLHTTKQKV---- 484  K...
XP_002141530              390 GILLYWAPYPFNCTTDKRRRAYDIALVQEWYKqhn-tshEHPV--------KIRVSYQKLLKNWILNSLHTRSARN---- 456  C...
XP_002179646              389 GVALYWAPYPFNTRAGRTRRVLDIPLIGHWFRdrvsrdmNYPT--------KVRVSYQKLLKAWVVSQLHSRPAKP---- 456  P...
CAM72305                  511 taaTaaegagtmdmsamQEKRRLEKMAGMRYFSKTRMEWLEAGLQVMRQGHNMLVQLINMKCLPYVHIDYNFEAKPTRTL 590  L...
XP_001330664              448 ---R-------------RRKTITKIFKTTPYFQSTTLDWVEAGLQVVQQGYNMCNLLIKRHRLVFLHLDYNFNLKPIKTL 511  T...
WGS:AAFB:cds.EHI_060350A  410 ---L-------------CKRNFFAALDETHFFYHTKLDWVEAGLQVIRQGYNILNLLIHRKNVDFLHLDYNFNIKPVRTL 473  E...
EDO41924                  406 ---Q-------------KKRYLFRSFKSTKFFQSTTLDWVEAGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTL 469  s...
EJP67483                  501 ---H-------------NNQNLLRSLKQTKFFQQTTIDWVEAGLQVCRQGFNMLNLLIHRKNLTYLHLDYNFNLKPVKTL 564  B...
Q6FQZ4                    543 ---H-------------KNYNLLKDLKSTKFFQETHIDWLEAGIQLCRQGHNMLNLLIHKRGLNYLHLDYNFNLKPTKTL 606  [...
XP_003676084              564 ---S-------------KKIKLLKNLRNTKYFQQTTIDWVEAGLQICSQGHNMLNLLIHKKGLTYLHLDYNFNLKPTKTL 627  N...
XP_016292505              485 ---H-------------KRTNLLRELNNTKFFQNTSIDWLEAGLQVAKQSFNMMNLLIHRKGASYLHLDYNMNLKPTKTL 548  K...
XP_002141530              457 ---C-------------RKRNFFKILQNTKFFQITETDWVEVGIQVCRQGYNMLNLLIHRKNLTYLHLDYNFNLKPIKTL 520  C...
XP_002179646              457 ---R-------------AKRSLFKSLKSTKFFQCTELDWVEVGLQICRQGHNVLNLLIQRKQLNYLHLDYNFNLKPTKTL 520  P...
CAM72305                  591 TTKEIKKSRLGPAFHMIRELLGFMKRLIDMHVMYRLGSTDALQLADATQYLFSHVGVLTGVYRYKLRAMRQIKRSRDLKH 670  L...
XP_001330664              512 NTKERRKSRFGNAYHLMREFFRFTKLLLDCHIQYRLGQIDAYVLADALQYVFSHAGHLTGMYRYKYKLMHQVRTCKDLKH 591  T...
WGS:AAFB:cds.EHI_060350A  474 TTKERKKSRFGNSFHLIREILKMTKIVVDAHCQYRLGRVDSYTLADGIQYIFSHIGTLTGMYRYKYKVIQQIRMCKDLKH 553  E...
EDO41924                  470 TTKERKKSRFGNAFHLCREILRLTKLIVDSHVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKH 549  s...
EJP67483                  565 TTKERKKSRFGNAFHLMREILRLTKLIVDAQVQYRLGNIDAFQLADGIHYAFNHVGQLTGMYRYKYKLMHQIRTCKDLKH 644  B...
Q6FQZ4                    607 TTKERKKSRFGNAFHLMREILKMIKLIVDAHLQFRLGNIDPFQLADGLYYILNHLGQLTGIYRYKYKVMHQIRACKDLKH 686  [...
XP_003676084              628 TTKERKKSRFGNAFHLMRELLKIVKLLVDAHVQYRLGNVDAFQLADGIYYILNHLGQLTGIYRYKYKVMHQIRACKDLKH 707  N...
XP_016292505              549 TTKERKKSRFGNAFHLVRELSRVMKLVVDAHVQFRLGSIDAFQLADGLQYLFNHVATLSGIYRYKYRSMRQIRACKDLKH 628  K...
XP_002141530              521 TTKERKKSRFGNAFHLCREILRLTKLVVDCHIQYRLGNIDAYQLADALQYIFNHVGQLTGMYRYKYRVMRQVRLCKDIKH 600  C...
XP_002179646              521 TTKERKKSRFGNAFHLVREILRLTKLVVDAHVQYRLSNIDAYQLADGLQYTFNHVGQLTGMYRYKYRLMRQIRTCKDLKH 600  P...
CAM72305                  671 MLYSKFNVGGVPSGPGNGFWGPAWRVWVFFMRGMTPLLQRYLSNLTDRVLHGRlqKGKMSGKKITRQRVEPDKDVNIKEA 750  L...
XP_001330664              592 VLYSRFNTGEVGKGPGVGFWGPMWRVWVFFMRGSIPLMERWLGSRVAREYEGR--FSKRLPSTVTKQRVESNYDIELRAS 669  T...
WGS:AAFB:cds.EHI_060350A  554 IIYYRFNTNSIEKGPGIGFWAPMWRVWIFLLRGLIPILERWLGNLLARQFEGR--KAKAIAKTITKQRVESGFDIELRAA 631  E...
EDO41924                  550 LIYYRFNTGAVGKGPGCGFWAPGWRVWLFFLRGIVPLLERWLGNLLARQFEGR--HSKGVAKTVTKQRVESHYDLELRAA 627  s...
EJP67483                  645 LIYYRFNSGPVGKGPGCGFWGPSWRVWLFFMRGIIPLLERWLGNLLSRQFEGR--HSKGVAKTVTKQRVESHFDLELRAS 722  B...
Q6FQZ4                    687 VVYSKFNK-IIGKGPGCGFWHPAWRIWIFFLRGIIPILERWLSNLLIRQFEGR---NNDIVKTTTKQRTDAYYDLELRAS 762  [...
XP_003676084              708 VVYYRFNK-ILGKGPGCGFWQPAWRVWIFFIRGIIPLLERWLGNLLNRQFEGR---SNEVVKTTTKQRVDAYYDLELRAS 783  N...
XP_016292505              629 VIYYRFNAAGVGKGPGVGFWAPSWRVWIFFLRGIVPLLERWLGNLLARQFEGR--AGRSGAQSITKQRVESAMDLELRAS 706  K...
XP_002141530              601 LIYHRFNTGSVGKGPGVGFWAPSWRVWVYFLRGIIPLLERWLSNLLARQFEGR--SNANPYKSISKQRVESHFDLELRAA 678  C...
XP_002179646              601 LIYYRFNTGPVGKGPGVGFWAPSWRVWMFFLRGITPLLEKWLGNLLARQFEGR--HSKSFAKNVTKQRVESHFDLELRAS 678  P...
CAM72305                  751 FRRELREMLPDNVKASVIVTMDQHMNEAFRHWRAGLPWSVPGLAKPLTDLVGKYVKLRSEEYIRTTQLQRRRIAEGDTVD 830  L...
XP_001330664              670 VLHDITDTMPEGIRNAKAHTVLAHMSEAWRCWKANIPWKVPGLPPPLEAIILRYVKAKADWWTKNAHYARERIARDGTVD 749  T...
WGS:AAFB:cds.EHI_060350A  632 VLHEINEIMPEGIKSNKAKTIMQHLSEAWRCWKANIPWKVPGLPEPIEAMILRYVKKKADWWTDVAHYTRERTKRGCTAD 711  E...
EDO41924                  628 VMHDILDMMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPGLPTPVENMILRYVKAKADWWTNTAHYNRERIRRGATVD 707  s...
EJP67483                  723 VMSDLMDMMPEGIKQSKVNTVLQHLSEAWRCWKSNIPWKVPGLPAPIENIILRYVKSKADWWISVTHYNRERIRRGATVD 802  B...
Q6FQZ4                    763 VMNDILDMIPEGLRQQKARTILQHLSEAWRCWKANIPWDVPGMPLPIKTIIERYVRAKADGWISSAHSNREKMKKGVHIE 842  [...
XP_003676084              784 VMNDILEMIPEGIRDTKARTILQHLSEAWRCWKANIPWDVPGMPEPIKNIIERYVKAKADGWMSSAHYNRERIKRGAHVE 863  N...
XP_016292505              707 VMHDILDAMPEGMRQNKIKTIMSHLQEAWRACRSNTPWS-PNLPAPIENLILRYVKQKFDWWTSVAHQQRARIARGATVD 785  K...
XP_002141530              679 VMHDILDMMPEQLRASKARPILQHLSEAWRCWKANLPWKVPGMPIPVENMILRYIKLKADWWTNAAYYNRERIRRGATVD 758  C...
XP_002179646              679 VMHDILDMMPAGVKQNKSRVILSHLSEAFRCWKANIPWKVPGMPAPIENMILRYVKAKADWWTNIAHYNRERIKRGGTVD 758  P...
CAM72305                  831 KQAFMKNLGRLTRLKLMDEQRRQRRYMT 858  Leishmania infantum JPCM5
XP_001330664              750 KAITRKNTGRLTRLYLKQQSDYQANYLK 777  Trichomonas vaginalis G3
WGS:AAFB:cds.EHI_060350A  712 KTVSKKNLGRLTRLWLKGEQERQFNYLK 739  Entamoeba histolytica HM-1:IMSS
EDO41924                  708 KTVCKKNLGRLTRLYLKAEQERQHNYLK 735  starlet sea anemone
EJP67483                  803 KTVAKKNVGRLTRLWLKAEQERQHNHMK 830  Beauveria bassiana ARSEF 2860
Q6FQZ4                    843 KNAAKRNLGRLTRLWIKNEQDRQAQIEK 870  [Candida] glabrata
XP_003676084              864 KTVMKKNLGRLTRLWIKNEQERQQEKEK 891  Naumovozyma castellii CBS 4309
XP_016292505              786 KTAVRKNQGRLTRLFLRAEQERQADYLK 813  Kalmanozyma brasiliensis GHG001
XP_002141530              759 KSVAKKNLGRLTRLYLKAEQERQLSYLK 786  Cryptosporidium muris RN66
XP_002179646              759 KSVVKKNLGRLTRLWLKAEQERQHNYLK 786  Phaeodactylum tricornutum CCAP 1055/1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap