3JB9


Conserved Protein Domain Family
PRO8NT

?
pfam08082: PRO8NT 
PRO8NT (NUC069), PrP8 N-terminal domain
The PRO8NT domain is found at the N-terminus of pre-mRNA splicing factors of PRO8 family. The NLS or nuclear localization signal for these spliceosome proteins begins at the start and runs for 60 residues. N-terminal to this domain is a highly variable proline-rich region.
Statistics
?
PSSM-Id: 400430
View PSSM: pfam08082
Aligned: 40 rows
Threshold Bit Score: 183.644
Threshold Setting Gi: 74621958
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3JB9_A         79 KADLPPEHLRKIMKDRGDMSSRKFRADKRSYLGALKYLPHAVLKLLENMPMPWEEYREVKVLYHVTGAITFVNESPRVIE 158  Schizosacchar...
XP_002179646   19 KETLPPDFLRKILQDHGDMSSKRYQSEKRIYLGALKYVPHALYKLLENIPMPWESYKEVPVLFHVTGAISFIDHVPTVIE 98   Phaeodactylum...
EON67260       72 KADMPPEHLRKIVKDIGDVSQKKFSSDKRSYLGALKFMPHAVLKLLENMPMPWESAREVKVLYHVNGCLTLVNEIPRVIE 151  Coniosporium ...
Q6CCC5         87 KADMPPEHLRKLIKDHGDMSSRKFASDKRAYLGALKFMPHGVIKLLENMPQPWEAVREVKVLYHISGAITFVNEIPRVVP 166  Yarrowia lipo...
Q6FQZ4        142 KIEMPPEHLRKIIDNHADISSRRFDHDKKSFLGALKYLPHAILKLLENMPQPWESNKEVKVLYHTAGAITFVNEIPRVIE 221  [Candida] gla...
Q6CXV6        133 KVEMPPEHLRKILNDHMDMTSSRFNSDKRAHLNALRYLPHAILKLLENMPQPWEQVKAVKVLYHVSGAITFVNEIPRVIE 212  Kluyveromyces...
CCF58376      140 KVEMPPEHLRKIIEGHSDMTSSRFNRDKRAYLGALKYMPHAVLKLLENMPQPWEQVKEVKVLYHVSGAITFVNESPRVIE 219  Kazachstania ...
CAM72305       63 KDLMPPEFIRKVVKDNGDLGGKRFKSERKLCVGMLPYIPLALLKLLENMPMPWEEARYVTVVYHVGGVLTIVDDTPTVAE 142  Leishmania in...
EGC35521       38 KEDMPPEHLRKIIKDHGDMSNRKFKDDKRVYLGALKYMPHAILKLLENMPMPWEQVKYVKVLYHLSGAITFVNEIPLVIE 117  Dictyostelium...
Q4E4S8         53 KDDVPPEYLRKLMKDNGDLSGKSFGTERKLCVALLKYMPLALYKLLENMPMPWEETRYVNVVYHMGGVLTLVDDTPTVAE 132  Trypanosoma c...
3JB9_A        159 PHFIAQWGTMWMMMRREK----RDRKNFKRLrFPPFDDEEPPFSI-DQLLDLEPLEAIRMDLDEEDD-APVMDWFYE 229  Schizosaccharomy...
XP_002179646   99 PVYRAQWGTAWLLMRREK----RDRRHFKRMrFPPFDDEEPPLDYaDHLLTVEPGEAVQLDLQQDDDyALLRDWFYE 171  Phaeodactylum tr...
EON67260      152 PVFHAQWATMWVCMRREK----SDRRHFKRMrFPPFDDEEPPLSWsENIEDVDPLEPIQMELDEEED-RAVIDWFYD 223  Coniosporium apo...
Q6CCC5        167 QVYTAQWATMWVMMRREK----RDRRHFKRMrFPPFDDEEPPISWaENIQDVEPPEGILMDLSPVDD-SAVVDWFYE 238  Yarrowia lipolytica
Q6FQZ4        222 PVYIAQWSTMWVAMRKEK----RDRTHFKRIrLPPFDDDEPPLSYsDHINDSDSQKGIQL-QSNDPDyAQVSDWLYD 293  [Candida] glabrata
Q6CXV6        213 PVYTAQWSTMWIAMRREK----RDRKHFKRMrFPPFDDDEPPLTYsDTIENLEPSEAITLDLDNYAH-DGVKDWIYD 284  Kluyveromyces la...
CCF58376      220 PIYISQWSTMWLAMRREK----RDRVHFKRMrFPPFDDDEPPLSYpEYIQSLECPESVTLELDSYDD-DAVRNWLYD 291  Kazachstania afr...
CAM72305      143 PLYVSQWGSMWTKMRANKvellQEGGGFRRA-VHKGDENEPPLDFaDYLMDRVPPPPVLDDLDEEDN-ASIVGWFYD 217  Leishmania infan...
EGC35521      118 PVYISQWATMWVTMRREK----RDRKHFRRMkFPCFDDEEPPLDYaDNILDIEVEDPVQMDLDENDD-EAVIDWFYD 189  Dictyostelium pu...
Q4E4S8        133 QLYLAQWGSMWTRMRSHKvelqQEGGAFRRM-IHKGNENEPPIEYgDYIMDREPPEAVHDELDEEDS-AAIIDWFYD 207  Trypanosoma cruzi
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap