3J3B,2ZKR,4A17,3J39,1VX7


Conserved Protein Domain Family
Ribosomal_L30_N

?
pfam08079: Ribosomal_L30_N 
Ribosomal L30 N-terminal domain
This presumed domain is found at the N-terminus of Ribosomal L30 proteins and has been termed RL30NT or NUC018.
Statistics
?
PSSM-Id: 400428
View PSSM: pfam08079
Aligned: 147 rows
Threshold Bit Score: 37.1835
Threshold Setting Gi: 74873282
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3J3B_F        20 KKRRNFAELKIKRLRKKFAQKMLRKARRKLIYEKAKHYHKEYRQMYRTEIRMARMARKAGNFYVPA 85 
CAP24714      16 KRRKQRADARTKAAQHKVTVAAKNKEKKSQYFKRAEKYVQEYRNAQKEGLRLKREAEAKGDFYVPA 81  Caenorhabditis briggsae
A0CZ75        20 KRQSRDSKLKALIYKRRVDRLAANKQARALWEKNAQAYEAEYKATDKSLVDNIRKAKADGGFYVPA 85  Paramecium tetraurelia
A0E8I8        20 KKTQRDSKLRDLVVKKRAERLGQNKVRRAQLEKSAQAYEAEYKATEKSLVDNIRKAKSEGGFYVPA 85  Paramecium tetraurelia
XP_004032259  27 KKQQRDEKLRKSALEARKTRSALMKQRKAEWTSKAQKYESEYVAQERRVVEEKRKARKSGSFFVPA 92  Ichthyophthirius multifiliis
EEC45178       9 KKEATQAKIQKAQAEATTAATAQGVADREAFAKQAQTYQDEYAAAEKAAVDNRRAAKVAGGFYVPA 74  Phaeodactylum tricornutum CCA...
EAX99917      11 KIAARVEAQKAAYLKKKEELLAAAKANEAKIQERAKKYAAEYVSQTKAEIDAENKATAEGAFYVPA 76  Trichomonas vaginalis G3
CDS43460     104 YKQMIRARRIKSEAKKKVIKRLKYLRLKKIYIKHAQKHLIEYRRAAKREINLMRSAQKAGNFYVPA 169 Echinococcus multilocularis
EIE91369      20 KKNKANAKAAEAAAADKVAARKAKLAKRRDLFKRAAKYHAEYKAAERKEITLRRQAKSNGNYYVPA 85  Rhizopus delemar RA 99-880
4A17_V        11 KKLARDEKLRKAKAEQRKASSAQMKQRKAEWISKAQKYAAEYEAAEKKIVDEKRKARKTGAFYVPA 76 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap