Conserved Protein Domain Family
PsaX

?
pfam08078: PsaX 
PsaX family
This family consists of the PsaX family of photosystem I (PSI) protein subunits. PSI is a large multi-subunit pigment protein complex embedded in the thylakoid membranes of green plants and cyanobacteria. PsaX is one of the 12 protein subunits found in PSI and these subunits are arranged as monomers or trimers within the membrane as shown by the structure of the trimeric complex from Synechococcus elongatus.
Statistics
?
PSSM-Id: 369686
View PSSM: pfam08078
Aligned: 10 rows
Threshold Bit Score: 33.1531
Threshold Setting Gi: 504938610
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_015181502     12 VAKSGGKFPYPFRAGWALLLLAINFLVAAFYFHII 46  Microcoleus sp. PCC 7113
WP_015200673      8 VAQTGAKSPYPFRTLVSVLLLAVNFLVAAMYFKVI 42  Calothrix parietina
jgi:Chro_0654    14 VAKSNANAPFPFRTIVSLILLAGNILVAAIYFHII 48  Chroococcidiopsis thermalis PCC 7203
P58566            9 VANTGAKPPYTFRTGWALLLLAVNFLVAAYYFHII 43  Nostoc sp. PCC 7120 = FACHB-418
WP_012410182     14 VADSGAKPPYAYRTGWAIFLLAINFLVAAYYFHII 48  Nostoc
WP_012629733      9 VAKTN-KPTYVFRTFWALLLLAINFIVAAYYFHIL 42  Cyanothece sp. PCC 7425
Q8DKP6            4 MATKSAKPTYAFRTFWAVLLLAINFLVAAYYFGIL 38  Synechococcus elongatus
WP_015125712      4 KTTKTAKPTYTFRASWAVLLLIINFVVAGYYFGVI 38  Synechococcus sp. PCC 6312
jgi:Cal7507_4732  1 MTAKSGKPNYAFRTGWALFLLAINFLVAAYYFHII 35  Calothrix sp. PCC 7507
WP_006616757      1 MANKSGGFPYPFRTFWAIVLLGINLVVAGYYFHII 35  Microcoleaceae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap