4WII,5CA5


Conserved Protein Domain Family
NOPS

?
pfam08075: NOPS 
NOPS (NUC059) domain
This domain is found at the C-terminus of NONA and PSP1 proteins adjacent to 1 or 2 pfam00076 domains.
Statistics
?
PSSM-Id: 400427
View PSSM: pfam08075
Aligned: 36 rows
Threshold Bit Score: 78.0014
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4WII_A       172 PVIVEPLEQLDDEDGLPEKLAQKN-PMYQKERETPPRFAQHGTFEYEYSQRWK 223
EGT35695     254 PLICEVLEPRDEDDGLAERMIPRT-PGLSKERELGPRFPTQNSFEYVYGMKWK 305 Caenorhabditis brenneri
XP_011430009 288 PISAENLEAKDEDDGLSEKFLPRN-QQYQAEREKEPRFAPPGSFEYRFGLKYr 339 Pacific oyster
XP_009016369 230 PIEVEFLEQKDENDGLPELFFTKT-SELLKDREKPPRFVQPGSFESDIGQKWK 281 Helobdella robusta
XP_002407174 434 PVLVEPLDLRDEEDGFPEKNVNKNnPQFLKEREVGPRFAEPGTFEFEFSSRWK 486 black-legged tick
XP_015786935 228 PVDVEPFDQKDEDDGFQEKHVNRNaPDFMTEREVGPRFAQPGTFEYEFAMRWK 280 two-spotted spider mite
XP_002407175 190 PIWAEPLEYRDWVLGLPERSVSRRgRGYAREREVGPRFARPGTQEHRVAERWK 242 black-legged tick
EDO38842     156 PISVEQYEQEDDEDGLVEKSVERQ-TGYQKEREVPPHFATPGTFESEWAQRWK 207 starlet sea anemone
5CA5_A       168 PLICEVLEPRDEDDGLAERMIPRT-PGLSKERELGPRFPTPNSFEYVYGMKWK 219
XP_030851278 254 PVTVEPLEQKDEEDGNQERYIMKN-REYQREREQPPRFAQPGSFEYEWGQRMK 305 purple sea urchin
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap