Conserved Protein Domain Family
CHDCT2

?
pfam08074: CHDCT2 
CHDCT2 (NUC038) domain
The CHDCT2 C-terminal domain is found in PHD/RING finger and chromo domain-associated CHD-like helicases.
Statistics
?
PSSM-Id: 400426
View PSSM: pfam08074
Aligned: 11 rows
Threshold Bit Score: 168.003
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q22516       1511 EYEIWHRRHDFWLLAAVAVYGYGR----YQinfqDIMNDPKFSIVNEPFKQTGadpatnfADVKNKFLARRFKLLEQSLV 1586 Caenorhabditi...
XP_001631649   24 CDDIWWRKHDYWLLAGVAYHGYAR----WQ----DIANHHMFAVINEPFKNVS-------LEYKNRFIARRFKLLEQALI 88   starlet sea a...
3_pfamImport    1 LNEIWHRRHDYWLLAGIVLHGYAR----WQ----DIQNDAQFAIINEPFKTEAnkg--nfLEMKNKFLARRFK-----VG 65  
Q8TDI0       1732 IYDIWHRRHDYWLLAGIVTHGYAR----WQ----DIQNDPRYMILNEPFKSEVhkg--nyLEMKNKFLARRFKLLEQALV 1801 human
ELW68711     1720 IYDIWHRRHDYWLLAGIVTHGYAR----WQ----DIQNDPRYMILNEPFKSEIhkg--nyLEMKNKFLARRFKLLEQALV 1789 Chinese tree ...
EDV24352       34 nyipWGRVHDYWFLVGVIKHGHGR----WQ----DILADDELSIISDSFIGKSf-----sSEIKNKYMAGRLKILEQALS 100  Trichoplax ad...
EGT46684     1455 HYEVWNRLHDFWLLFGTATHGYSRssvsWQ----DVCNDPRCTIINEAFNRISdvenktyPDIKARFIQQRLKLLEQSLV 1530 Caenorhabditi...
5_pfamImport    1 EYEIWHRRHDYWLLAAIVIHGYGR----YQinfqDIISDPRFSIVNEPFKQEVqgsglnfADVKIKFLQRRFKLLEQALV 76  
NP_504523    1524 EYEIWYRRHDYWLLAGVVVHGYGR----FQanfnDIINDPRFSVLNEPFKEVGaea--tgSDIKAKFMQRRFKLIEQSLV 1597 Caenorhabditi...
PNJ12822       28 LNEIWHRRHDYWLLAGIVLHGYAR----WQ----DIQNDAQFAIINEPFKTEAnkg--nfLEMKNKFLARRFKLLEQALV 97   Sumatran oran...
XP_009859352 1628 LNEIWHRKHDYWLIAGIAIHGYAR----WS----DIQNDVRFAIVNEPFRAMHekg--nfLEMQNKFLARRYKLLEQALV 1697 vase tunicate
Q22516       1587 IEEQLRRAAHINK-QQSPDQVGQLAQHFSELEHTADAHVNIARESNNGNRNANAILH 1642 Caenorhabditis elegans
XP_001631649   89 IEEQLKRADKLNLkQDAQHPAMALNARFAELECLAESHQHLSKESLSGNKPANAVLH 145  starlet sea anemone
3_pfamImport   66 MREEWNRV------QEGPGRAGS-GQVWWSPECPGPAVRTQWVSSAVGSSVVSPTLH 115 
Q8TDI0       1802 IEEQLRRAAYLNMtQDPNHPAMALNARLAEVECLAESHQHLSKESLAGNKPANAVLH 1858 human
ELW68711     1790 IEEQLRRAAYLNMtQDPNHPAMALNARLAEVECLAESHQHLSKESLAGNKPANAVLH 1846 Chinese tree shrew
EDV24352      101 IEEQLRRADQSTS-ISDEPSYLSLEHGLREIEYMLEAHQHLLAD---DSQTTRDILQ 153  Trichoplax adhaerens
EGT46684     1531 IEEQLRRAAFLNM-QNHPENIGNLAHNYATLEFVADAGAYLSAESRNGDRNANVVLH 1586 Caenorhabditis brenneri
5_pfamImport   77 IEEQLRRAAHIKG-QMQPENVGPMAQHFSDLQSTADSHLNIARESSAGNRNANTILR 132 
NP_504523    1598 IEEQLRRAAHANR-HLQPDNVGPLAQRFADLENIAESQANIAKESSAGNRNANAVLH 1653 Caenorhabditis elegans
PNJ12822       98 IEEQLRRAAYLNLsQEPAHPAMALHARFAEAECLAESHQHLSKESLAGNKpanavlh 154  Sumatran orangutan
XP_009859352 1698 IEEQLRRASYLGLvQDTKHPAMSLNARFAEVECLAESHQHLSKESLAGNKPANAVLH 1754 vase tunicate
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap