2N5N


Conserved Protein Domain Family
CHDNT

?
pfam08073: CHDNT 
CHDNT (NUC034) domain
The CHDNT domain is found in PHD/RING finger and chromo domain-associated helicases.
Statistics
?
PSSM-Id: 400425
View PSSM: pfam08073
Aligned: 21 rows
Threshold Bit Score: 80.8063
Threshold Setting Gi: 341890749
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2N5N_A         25 DHVFSEEDYRTLTNYKAFSQFVRPLIAAKNPKIAVSKMMMVLGAKWREFSTNNP 78  
Q22516         97 DVDYEQEEFQSITNLKNFSSLVKPYILKVNPGTNVTKMYPLFQVKYKEFQDHMT 150  Caenorhabditis elegans
G5EBZ4         95 EFDYDEEEFQGISNLKTFSSIIKPQILEANPGTNVSKMYPMFQVKYKEYQDHMa 148  Caenorhabditis elegans
2_pfamImport    1 EVDYDQAELQGVSSIKAFTAVIRQQLLEANPGTNLSKMYPLQQVKYREFQEHMT 54  
5_pfamImport    1 EIDFEQEEFQKVTNLKVFSNIIKPLVLKVNPGTNVSKMYPLFQVKYKEFQDHMT 54  
EKC37026      112 DIPFDDDDYISLNNYKLFKQHVQPIIQKANPKVAMAKMVTLIGAKWREFAQiva 165  Pacific oyster
XP_018668322  144 EHEHDEQDYSTLTTYRLFSQHIKPMLARVYPRLPISRTLTIVAAMWREFSNspk 197  vase tunicate
Q14839        164 DHVFSEEDYRTLTNYKAFSQFVRPLIAAKNPKIAVSKMMMVLGAKWREFSTNNP 217  human
XP_013930890   24 DHVFTEEDYHTLTNYKAFSQFMRPLIAKKNPKIPMSKMMTIMGAKWREFSANNP 77   Thamnophis sirtalis
XP_030842508  127 EMEYTESDYDELINYKLYTDNIRPLVLENAPKLHSQKLVNLLAALWKEFAANNP 180  purple sea urchin
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap