Conserved Protein Domain Family
NADH_oxidored

?
pfam08040: NADH_oxidored 
MNLL subunit
This family consists of the MNLL subunits of NADH-ubiquinone oxidoreductase complex. NADH-ubiquinone oxidoreductase is involved in the transfer of electrons from NADH to the electron transport chain. This oxidation of NADH is coupled to proton transfer across the membrane, generating a proton motive force that is utilized for the synthesis of ATP. MNLL subunit is one of the many subunits found in the complex and it contains a mitochondrial import sequence. However, the role of MNLL subunit is unclear.
Statistics
?
PSSM-Id: 400407
View PSSM: pfam08040
Aligned: 11 rows
Threshold Bit Score: 80.5621
Threshold Setting Gi: 118788550
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O75438         1 MVNLLQIVRDHWVHVLVPM-GFVIGCYLDRKSDERLTAFRNKSMLFKRELQPSEEVTWK 58  human
XP_012308560   1 MVNFLQLVRDQWVVLFVPM-GFVLGCYLDRKNDEKLTAFRNKSMLYKRELRPNEEYTWK 58  Ma's night monkey
XP_015206698   1 MVNLVNMLREHWVNVLVPL-GFVIGIYMDRRNDEKLTAFRNKSMLYKRELKPGE-VTWK 57  spotted gar
XP_007255535   1 MVNFALLVREHWVNVLVPL-GFVVGVYLDRWNDQKLTAFRNKSALYSRELKPGEEYTWK 58  Mexican tetra
XP_027895384   1 MVKFALPTSVNWAHILVPM-GFVIGWYLDKQQDQKLTAFRNKSALYKRELKPGEEVTWK 58  Monterrey platyfish
EGW09726       1 -mTLLQLVRDHWVHILVPM-GFAFGYYLDKRADEKLTTFRNKSMLFRRELRPNEEVTWK 57  Chinese hamster
XP_007472620   1 MMNLILAVRDHWVHILVPM-GFVVGYYLDKKSDEKLTAFRNKSMLFKRNLKPNEEVTWK 58  gray short-tailed opossum
XP_007658719  30 MVNFVQIVCDHWVHVLVPM-GFVIGWYLDKRSDEKLTAFANKSKLFGRELKsdedtrk- 86  platypus
XP_555840      1 MFGL----NRQYLWSVVPLfGFGVGWFLDRKETERMTMFRDKSALYGRTLKEGEKPSWP 55  Anopheles gambiae str. PEST
XP_019953195  50 MVNFISLARDHWVNILVPM-GFVIGWYLDKQQDQKLTAFRNKSILFSRELKPGEEVTWK 107 Japanese flounder
XP_004018002   1 MMNLLQVVRDHWIHVLVPV-GFVFGYYLDRKNDEKLAAFRNKSLLYKRELKPNEEVTWK 58  sheep
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap