Conserved Protein Domain Family
Mit_proteolip

?
pfam08039: Mit_proteolip 
Mitochondrial proteolipid
This family consists of proteins with similarity to the mitochondrial proteolipids. Mitochondrial proteolipid consists of about 60 amino acids residues and is about 6.8 kDa in size.
Statistics
?
PSSM-Id: 400406
View PSSM: pfam08039
Aligned: 2 rows
Threshold Bit Score: 114.034
Threshold Setting Gi: 311261637
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003128804  1 MLQSLIKNVWIPLKPYYTQVYQEIWVGMGLMGFIVYKIRSADKRSKALKASSPAPAHGHH 60  pig
XP_008543016 35 MLQSLIKNVWVPMKPYYTQVYQEIWAGMGLMGFIVYKIRSADKRSKALKASSPVPAHGHH 94  Przewalski's horse
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap