5Z1W


Conserved Protein Domain Family
PKD_channel

?
pfam08016: PKD_channel 
Click on image for an interactive view with Cn3D
Polycystin cation channel
This family contains the cation channel region of PKD1 and PKD2 proteins.
Statistics
?
PSSM-Id: 400395
View PSSM: pfam08016
Aligned: 11 rows
Threshold Bit Score: 421.368
Threshold Setting Gi: 341941262
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5Z1W_C   84 SFQTISSMSDFWDFAQGPLLDSLywtkwYNNQSlgrgshsfiyyeNLLLGAPRLRQLRVRNDs--cVVHEDFREDILn-- 159  house mouse
O08852 3703 AFLAITRSDEFWPWMSHVFLPYV-----HGNQS------------SPELGPPRLRQVRLQEA----FCPDPSSSEHM--- 3758 house mouse
Q95V80 2213 DYHLMNDFRSFLKWADSTLLPGL-----LSENRwgae-----kqsTLIGGGLRLRQVRVKPSs--cETHPLFVDLINd-- 2278 purple sea urchin
Q9VK95  404 GNYLKDDSDSI-----------------QANMSfhhlegrvflyeNLLLGPPRLRQIRVRKEs--cYVNDAFIRYFNt-- 462  fruit fly
Q9U1S7  121 AFGSCTSMDNIWDWLSQVLIPGIyw-teTSNSTdnenm---iyyeNRLLGEPRIRMLKVTNDs--cTVMKSFQREIKe-- 192  Caenorhabditis elegans
O35245  267 NFKTLSSMEDFWKFTEGSFLDGLywkaqTSNHTqadnrs-fifyeNLLLGVPRLRQLRVRNGs--cSIPQDLRDEIKe-- 341  house mouse
Q9Z0T6 1623 DLATVMKLGDIYTWLHGVFLPLL-----HNDPNptfl----pdssSKILGLPLVRQVRARPSnktcLLAKKFVQSSVage 1693 house mouse
Q8T8Z2  171 GLSQVYFIYQVHSYMKITLVEAF-----YAQKTngyegw-wameqWQKIGVVRLRQMRPVD------------------- 225  fruit fly
Q9VVZ8  167 GLLSVGDVPDIYFFVVSSLVLAF-----TDGKNtsggapwihaegTRLLGVVRLRQLRTES------------------- 222  fruit fly
Q9W4X5  171 GLQEVYFLNQLFDFIESTLVLAF-----NSNSTesgspgwahaeqSVLLGVMRLRQLRVSN------------------- 226  fruit fly
Q9NTG1 1750 DLATVTKLEDIYRWLNSVLLPLL-----HNDLNptfl----pessSKILGLPLMRQVRAKSSekmcLPAEKFVQNSIrre 1820 human
5Z1W_C  160 --CYDVYSPDKEDq-----------LPFGPQNGTAWTYHS-----------QNELg-------------GSSHWGRLTSY 202  house mouse
O08852 3759 --CSAAGSLSTSDygi-------gwQSVVQNGSETWAYSA-----------PDLL--------------GAWYWGYCAVY 3804 house mouse
Q95V80 2279 --CRALFTPESEDrelyn---aswsQPIVNMSALLNSSQT-----------VEEWslsnyspwhfypdkAVGMWGHATSL 2342 purple sea urchin
Q9VK95  463 --CYAAYSSGAEDr-----------KPMHKGSP----FRT-----------MHDLd-------------STPIWTVLAFY 501  fruit fly
Q9U1S7  193 --CFANYEEKLEDk-----------TMVGDGSVDAFIYAT-----------AKELe-------------NLKTVGTIASY 235  Caenorhabditis elegans
O35245  342 --CYDVYSVSSEDr-----------APFGPRNGTAWMYTS-----------EKELn-------------GSSHWGIIASY 384  house mouse
Q9Z0T6 1694 ihCHPQYGIDPEDtqhyssvwskagKQSTDKASHGFTYKP-----------PGKRw-------------VYHSYGVLNTY 1749 house mouse
Q8T8Z2  226 --CHIGLGKPEWDkktyapewrlpyHRMHYTEKFWRIYDPfvpaefepsflNGLLl-------------NYDHYGYLLNY 290  fruit fly
Q9VVZ8  223 --NRLGLSLPVFTerdfseswtlpyERVPYTDKYWPIYTPwlpsv--svarDNLLm-------------GINHVGHMFNY 285  fruit fly
Q9W4X5  227 --PQVGLGPPKFSdtyympdwqlpyRKLHYSDKYWRIYEPwipikmgfeflDALLm-------------NFDHVGSLNSY 291  fruit fly
Q9NTG1 1821 ihCHPKYGIDPEDtknysgfwnevdKQAIDESTNGFTYKP-----------QGTQw-------------LYYSYGLLHTY 1876 human
5Z1W_C  203 S-GGGYYL-DLP-GSRQASAEALQGLQEGLWLDRGTRVVFIDFSVYNANINLFCILRLVVEFPATGGTIPSWQIRTVKLI 279  house mouse
O08852 3805 D-SGGYIQ-ELG-LSLEESRARLGFLQLHNWLDSRSRAVFVELTRYSPAVGLHAAVTLRLEFPVAGHALAAFSVRPFALR 3881 house mouse
Q95V80 2343 P-SSGYIW-VLG-SMYEEAKDSLAEMVDARWLDARTRALFVEWTSYNANTNLFCVVTFLMETPASGGLLKLPEVQAVRLH 2419 purple sea urchin
Q9VK95  502 R-TGGYTV-NLD-YDKDRNVKIINDLKDIHWLDRGSRLCLVEFNLFNENTDIFQSIKLIAEIPPTGGVIPQAHLQTVKMY 578  fruit fly
Q9U1S7  236 G-GGGFVQ-RLPvAGSTEAQSAIATLKANRWIDRGSRAIIVDFALYNANINLFCVVKLLFELPASGGVITTPKLMTYDLL 313  Caenorhabditis elegans
O35245  385 S-GAGYYL-DLS-RTREETAAQLAGLRRNFWLDRGTRAAFIDFSVYNANINLFCVVRLLAEFPATGGVVPSWQFQPVKLI 461  house mouse
Q9Z0T6 1750 G-SGGYVFyFFPgQQMFNSTVRLKELEGKNWLDELTWAVIVELTTLNPDTSLMCSISVVFEVSPLGVVNSSLSVYSFSLA 1828 house mouse
Q8T8Z2  291 PeVAGYVV-LMM-STKINCLKQIEYLRDYSWLDKNTSALFIDLTMYNADANLFTLITLRVENSPFGIQLPRVHVDSVSML 368  fruit fly
Q9VVZ8  286 PeSKGYKV-LLS-DTRHKSLKIIDYLMKKNWLDANTTALFMDFSLYNADANTFTVCTLWVEKFPYQYPDGHTRIESHTFV 363  fruit fly
Q9W4X5  292 PeLAGYVS-LLA-RSAANSMKVIDYLSENHWLTLNTSAVFIDFTLYNVDVNLFSICTLRVEKTPFGGIVPDVQVDSAKLL 369  fruit fly
Q9NTG1 1877 G-SGGYALyFFPeQQRFNSTLRLKELQESNWLDEKTWAVVLELTTFNPDINLFCSISVIFEVSQLGVVNTSISLHSFSLA 1955 human
5Z1W_C  280 RYVNNWDFFIVGcEVVFCVFIFYYVVEEILEIHLHR-LRYLS-SVWniLDLVVILLSIVAVGFHIFRTLEVNRLMGKLL- 356  house mouse
O08852 3882 RLSTGLSLPLLT-SVCLLLFALYFSMAEVQTWRKDGcACTARpDTW--ARCLLVILTAATGLVRLAQLGIADRQWTHFVq 3958 house mouse
Q95V80 2420 RYAANYKLFVILcEILFVVALFFVMYREYVRYKPIGiRKYLS-DKWnlLEIAIIVNCIVSAGLYIYRYVITKQLFKQMR- 2497 purple sea urchin
Q9VK95  579 SFFTDRSMLMTViYIFWYIMVIYYTIYEITEIRKSGiKIYFC-SMLniLDCAILLGCYLALVYNIWHSFKVMSLTARA-- 655  fruit fly
Q9U1S7  314 TYQTSGGTRMMIfEGIFCGFILYFIFEELFAIGRHR-LHYLT-QFWnlVDVVLLGFSVATIILSVNRTKTGVNRVNSVI- 390  Caenorhabditis elegans
O35245  462 RYVTAFDFFLAAcEIIFCFFIIYYVVEEILEIRIHR-LSYFR-SFWncLDVVIVVLSVVAMVINIYRMSNAEGLLQFL-- 537  house mouse
Q9Z0T6 1829 DFNRKTSSEIYL-YAAILIFFCAYVVDEGYIIRQER-ASYIR-SVYnlLNFSLKCMFALLIVLFFWKYFLATKMVQLYL- 1904 house mouse
Q8T8Z2  369 GNVETRSNSELLiLFVYTVLVILFARGVFTKIWHH--PAAAH-EAWtmVDLAIYILNVFLTVLAIMRDIETDALLQIIEt 445  fruit fly
Q9VVZ8  364 EQLREFTKFGMLmVFVFVVTWLQFTKAFFLKVWYD--PRQLK-TLWvqVDAMIVALSLVVGMIMSVRDNLVQKMIKSVEi 440  fruit fly
Q9W4X5  370 ENVDQMPYTGLLaLLIYVLVFIQFAQTLAVKLWYE--PHLLK-SVWnkLDLFIFMVNVLVVVLVVLRESLVASMMKKVEg 446  fruit fly
Q9NTG1 1956 DFDRKASAEIYL-YVAILIFFLAYVVDEGCIIMQER-ASYVR-SVYnlLNFALKCIFTVLIVLFLRKHFLATGIIRFYL- 2031 human
5Z1W_C  357 QQPDTYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGFAIMFFIVFFAYAQLGYLLF 436  house mouse
O08852 3959 DHPRHFTSFDQVAQLGSVARGLAASLLFLLLVKAAQQLRFVRQWSVFGKTLCRALPELMGATLGLVLLGVAYAQMAILLI 4038 house mouse
Q95V80 2498 DESVRFVGFRTAATSDNALGYSLAVIIILSCVKFLYLLRLNPRMYLLTSVISDCYHEVIAFTFLIFILILSFAFPMTIMF 2577 purple sea urchin
Q9VK95  656 HSDVTYQSLDVLCFWNIIYVDMMAILAFLVWIKIFKFISFNKTLVQFTTTLKRCSKDLAGFSLMFGIVFLAYAQLGLLLF 735  fruit fly
Q9U1S7  391 ENGLTNAPFDDVTSSENSYLNIKACVVFVAWVKVFKFISVNKTMSQLSSTLTRSAKDIGGFAVMFAVFFFAFAQFGYLCF 470  Caenorhabditis elegans
O35245  538 EDQNSFPNFEHVAYWQIQFNNISAVMVFLVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGFTIMFSIIFLAYAQLAYLVF 617  house mouse
Q9Z0T6 1905 ADPEAFIPFHAVSRVDHFMRIILAFLLFLTILKTLRYSRFFYNVRLAQKAIQAALPGICHTALVVSIYSFMYVAFGYLVF 1984 house mouse
Q8T8Z2  446 ATKGQYLDFQRPLRLHQMLFIVKGFLVCITTLRLWKVLQFASVFQHFTQTLFSAWRAVASLGVIILVVLMAIGITLAVPN 525  fruit fly
Q9VVZ8  441 AVVVDFLDFREPAQLAYLEDVVTGLAVALVTMRLWKVLQFSATFQLFTKTIAMAWDALLCTFVITVIFIIAIGIATVTIN 520  fruit fly
Q9W4X5  447 ASKMEFIDFRRPSRMHQLTTITIGFLICITTLRLWRVLQFASVFKLFTRTLYLAWSAVASTAIAIVIFLIGFCFAVVTIN 526  fruit fly
Q9NTG1 2032 SNPEDFIPFHAVSQVDHIMRIILGFLLFLTILKTLRYSRFFYDVRLAQRAIQAALPGICHMAFVVSVYFFVYMAFGYLVF 2111 human
5Z1W_C  437 GTQVENFSTFVKCIFTQ-----FRIILGDFDYNaidn------anriLGPVYFVTYVFFVFFVLLNMFLAIINDTYSEV 504  house mouse
O08852 4039 SSGADTLYNMARAFLVLcpgarVPTLCPSESWY--------------LSPLLCVGLWALRVWGALRLGAILLRWRYHAL 4103 house mouse
Q95V80 2578 GSNLPDYRDITKTALNL-----FITLPDNFVYEdlks------vqrvLGPLILLLFQFLSCYLFLDLLIAALNESMVTI 2645 purple sea urchin
Q9VK95  736 GTKHPDFRNFITSILTM-----IRMILGDFQYNlieq------anrvLGPIYFLTYILLVFFILLNMFLAIIMETYNTV 803  fruit fly
Q9U1S7  471 GTQIADYSNLYNSAFAL-----LRLILGDFNFSales------cnrfFGPAFFIAYVFFVSFILLNMFLAIINDSYVEV 538  Caenorhabditis elegans
O35245  618 GTQVDDFSTFQECIFTQ-----FRIILGDINFAeiee------anrvLGPLYFTTFVFFMFFILLNMFLAIINDSYSEV 685  house mouse
Q9Z0T6 1985 GQHEWNYSNMIHATQTI-----FSYCVSAFQNTefsg-------nkvLGVLFLSSFMLVMICIFINLFQAVILSAYDEM 2051 house mouse
Q8T8Z2  526 GNNAVVFSHMVQSVVTC--------MWYSMGFNgdihpadffhggriLGILLYLALVFLLAIILMNVFASVIYDYFNET 596  fruit fly
Q9VVZ8  521 GNYTSNFRDFPKGIVTV--------TCFAFGYTnlvyppdifyggewLGILLYTIMGFVVKYMLINLIVSMMRDQMASV 591  fruit fly
Q9W4X5  527 GNYSSNFNKLVKSMVMC--------MCYSFGFSaqvkpselfhggkwLGILCYGVLAFVIIVLLINVFVSLINDYFTva 597  fruit fly
Q9NTG1 2112 GQHEWNYSNLIHSTQTV-----FSYCVSAFQNTefsn-------nriLGVLFLSSFMLVMICVLINLFQAVILSAYEEM 2178 human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap