Conserved Protein Domain Family
DUF1702

?
pfam08012: DUF1702 
Protein of unknown function (DUF1702)
This family of proteins contains many bacterial proteins that are encoded by the UnbL gene. The function of these proteins is unknown.
Statistics
?
PSSM-Id: 400392
View PSSM: pfam08012
Aligned: 29 rows
Threshold Bit Score: 391.214
Threshold Setting Gi: 505434175
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Caci_6382      5 MAGSIRKLLTAPDLGSTSFETLGY--------DTKHAPARTQLEASARQFIIGYEFGIEQREHTGLVDRLEALQ-REYRG 75  Catenulispo...
DU:RAM_35265       4 FIGVLRKQVLAPSFASVGFAGRNF--------PVTHTDATARLEAVPQAVVCGFEWAIEGASLWEIERRLALIE-PEQRG 74  Amycolatops...
jgi:Sros_7003      4 LFGSLRRLLMTPSLAEVSFEGRGF--------PVTPSDATRRLEAIPQAVICGFEWGIDARDQWEVERRLSMVD-PEQRG 74  Streptospor...
EFG05307          31 ALGSLRRLLMAPPLAEVGFSARGF--------GVPPTELTRRLEAIPQAVVCGFEWAIDTRGTWETERRTLLVE-PELRG 101 Streptomyce...
jgi:Strop_2701     4 VVGSVRRLLLAPELADVSFRRRGF--------PATPSATTERLEAVPRAVICGFEWGLDTRDQWELERRVELVE-EELRG 74  Salinispora...
jgi:Hoch_0696     16 wllsiKVRLFGIADEEATFERRGF--------TASHPVIRHRLESIGFTFIHGYMVALRCTDPNSMAIALAEVE-PAQRG 86  Haliangium ...
WP_014148088       4 fFGRCRHALFGISDAETRIELRGF--------KVGDDRVKARIERIGKSFVEGYHAALLDNDPLRLTEHLNSIDdNELRG 75  Methylomicr...
WP_013320461      32 pWEWLRKQLFSLSPEEATFKRRGF--------YASVAEIQEHLETIGCTFVEGYQAVINDENPEIFLGKLKASE-AELAG 102 Gloeothece ...
jgi:PCC8801_2243  26 VFGQLRQTLLRISRKEATFAKRGF--------LPTHPKTQKHLETIGKTFLQGYEIAIALSHPPSVITQLNEIA-TEYRG 96  Rippkaea or...
BAG01096          45 qvnrfpqRLLLLSPQAATFNQRGFicdpqsrsPAVQPQKQIYLETIGQTFIYGYNAAIMAHSLTDLFPLLEGVT-LNLRG 123 Microcystis...
jgi:Caci_6382     76 FAYEGAVMALSMRDVMSplpgRRRTESFLAGpgyddgPGSRHIFMAYIGLGFAIARLPGAMWRRALP-----------RQ 144 Catenulispo...
DU:RAM_35265      75 FAYEGATMGYTILDAMPgg-gRDRTRALLEG------PGRPHIFLTYIGIGFAMARLPRPLWKNILP-----------EL 136 Amycolatops...
jgi:Sros_7003     75 FAYEGATMAFTILDAMGgg-rGHRTRDLLLG------PGQPHIFLTYIGIGFAMARLPRPLWKKVMP-----------DL 136 Streptospor...
EFG05307         102 FVYEGATMALTIRDAMGpg-rGRRAAELLRG------PARQHVFLNYIGIGFAMARLPRVLWKKVLP-----------DL 163 Streptomyce...
jgi:Strop_2701    75 FAYEGATMACTVLDALPg--rSGRTRALLLG------PGQPHLFLAYIGIGFAMARLPRPLWRGVLP-----------DL 135 Salinispora...
jgi:Hoch_0696     87 FAFEGAAMAMALQDLLSpw-rRNRLQNLLKG------AGRAHSYMVYIGAGWAFARLRLGQGRYFRRm------------ 147 Haliangium ...
WP_014148088      76 FLFEGAAMGLVISDFLCpw-rPSRFQAFLTG------PAQHHAYMLHVGAGWALARLPVSPASLTSRm------------ 136 Methylomicr...
WP_013320461     103 FAFEGAAMALFLLDQLTpw-rGDRFLEFVGG------PGNPYIYMSYVGAGWGLARLQWRLKPYLHQls-------cgAS 168 Gloeothece ...
jgi:PCC8801_2243  97 FAFEGAAMGLGLLDYLTpw-nRTRIGEFLAS------EGVNHIYMTYMGMGWLLARLSGSIQSYLTRiqesdlnlsphPI 169 Rippkaea or...
BAG01096         124 FAYEGAAMALSLLDCLTlg-kCDRFEHFLAN------EGKKHIYMAYVGKGWQLARIPFSLRFYLQKl---------aDS 187 Microcystis...
jgi:Caci_6382    145 SKLPDHPSLRGLILDGYGFHMAFFHHTKWVDGQYAPPRYH-WPAPHTLTQRVVDQGVGRAMWFVYGGDVERLMEAVERFG 223 Catenulispo...
DU:RAM_35265     137 TGVPYHPVMSWLAVDGYGFDRAYFDTRRWVDEQAEPEPYP-WAGRPEYFARAFDQGVGRALWFINGGVPSAVAEAVGRFA 215 Amycolatops...
jgi:Sros_7003    137 SGSAYYPTMSWLAVDGYGFDRAYFDTRRWVDEQRVPASYP-WEGSPDYFPRAVDQGIGRALWFIHGGQVPDVASAVGRFA 215 Streptospor...
EFG05307         164 TGSDYYPVMSWLAVDGYGFDLAYFHTRRWVNEQRVPDPYP-WEGAPDYFPRAVDQGIGRALWFIHGADVSRVAPAVERFS 242 Streptomyce...
jgi:Strop_2701   136 DGIVYHPTMSWLAVDGYGFDRAYFDTVRVVDRQERLAAYP-WQGAAEYFPRAVDQGIGRALWFIHGGRVPNVAAAVGRFA 214 Salinispora...
jgi:Hoch_0696    148 -----DPLLRWLAIDGYGFHEGYFHPRRTIDASKQPRGLR------GYGHRAFDQGLGRSLWFVCGADAERITRTIAKLA 216 Haliangium ...
WP_014148088     137 -----DCLLRWLVLDGYGFHEGYFHWPDSIGRQQRPSCLQ------GYEKRAFDQGLGRSLWFVMGADPERIVSALQDFP 205 Methylomicr...
WP_013320461     169 VGQFPDPLLGWLAIDGYGFHQGYFQGRKYIETLAFPSELSaW----SYALKVFDQGLGRSLWFVQGADVARIAQKIQQFP 244 Gloeothece ...
jgi:PCC8801_2243 170 IPSPPHPLIGWLTIDGYGFHQGYFHWQDYIQNLKPPTNLS------GYSCRVFDQGLGRSLWFVKGANILAIEAAIAQFD 243 Rippkaea or...
BAG01096         188 AQHFPDSLLGWLALDGYGFHQGYFAWPKYIRERKSPQELS------GYARLVFAQGLGRSLWFVKGANIAEIADQIQKFD 261 Microcystis...
jgi:Caci_6382    224 PERRSDLMSGAGLAASYAGGVDDDALDLLWTKGHQYRPELAQGAVWALRARDVSNLITPENEAAAQRFCGCSAVEASQIA 303 Catenulispo...
DU:RAM_35265     216 EPRRADLWSGVGLASTFAGGTDQAGYGQLRRAAGEYFAELALGVVFAVKARTYSGHVPAHTHLAAGVLVNLSVQGAQTIA 295 Amycolatops...
jgi:Sros_7003    216 SHRQADLWSGVGLASTFAGGAGSEALATLRREAGEHRAELAQGVVFAVKARDFSGFVPPHTEAAAAVLADLSIKDAVALA 295 Streptospor...
EFG05307         243 THRRADLWSGVGLAATFAGCCAPEQLRTLRDAAAGYGEHLAQGAVFAAKARDYAGTVPEHTHAATAALTGLTVEAAVRLA 322 Streptomyce...
jgi:Strop_2701   215 AERQPDLWSGVGLAATFAGGCDA---GPLHRAAGGHASDLAQGAVFAAKARSWSGCVPEHTRTALVGLTGLTVEAAVGLA 291 Salinispora...
jgi:Hoch_0696    217 PERHEDLWSGIGLAAAYAGGVSATDLEMLRKLAGAYLPAVAQGAAFAAKARQRAGNPTEHTELGCNIFCGESLRESAHAT 296 Haliangium ...
WP_014148088     206 TDRQGDLWSGVGLAGAYAGGVEPDVLERLKVLAGDFLAHLAQGAAFAAKARQRAGNPADHTKLACRIFCNLSAEHAAQLT 285 Methylomicr...
WP_013320461     245 PYRRADLWSGVGLACTYAGGVDRASIEQLRRLAAAYLPQIAQGAAFAAKTRIRAGNMTENTEMCCQVLCGMSAEPAATIT 324 Gloeothece ...
jgi:PCC8801_2243 244 PMRRADLWSGVGLACGYAGGVEKTALERLKAMAQPYYSQLAQGVAFAAKTCIRAGNLTEHTEIAAQVLCGMSAQQAAQIT 323 Rippkaea or...
BAG01096         262 PLLQPHLWSGIGLACTYAGGVSPEEIQHLKQLAEPYRAELAQGAAFAAKARLLAENCQENTEIACQILCGMAITETAKIT 341 Microcystis...
jgi:Caci_6382    304 ADVAEKLPLDSS-LATYEEFRRRVRLRF 330 Catenulispora acidiphila DSM 44928
DU:RAM_35265     296 DRTEAADGDDGP-EPPYELWRERIRRDF 322 Amycolatopsis mediterranei S699
jgi:Sros_7003    296 DDTAVDPYGSGP-VPQYELWRSRIRSHF 322 Streptosporangium roseum DSM 43021
EFG05307         323 DDSSVAGRESGS-LPAYELWRQNIRSGi 349 Streptomyces clavuligerus ATCC 27064
jgi:Strop_2701   292 DEVAVTGPIDGQ-VPPYEMWRNRVRARF 318 Salinispora tropica CNB-440
jgi:Hoch_0696    297 DAVLEGLGGDTSdQPAYEQWRQRIQHYF 324 Haliangium ochraceum DSM 14365
WP_014148088     286 DDALRKVPADNA-LPAYEHWRQRIRRHF 312 Methylomicrobium alcaliphilum
WP_013320461     325 DLSLIGLSSQAT-TPAYEIWRQRIQNHF 351 Gloeothece verrucosa
jgi:PCC8801_2243 324 DDTLVGLFDTPE-ITAYEQWRQRIQNQF 350 Rippkaea orientalis PCC 8801
BAG01096         342 DDTLIGLDYHDQ-IPAYEQWRQAIQSHF 368 Microcystis aeruginosa NIES-843
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap