Conserved Protein Domain Family
CDP-OH_P_tran_2

?
pfam08009: CDP-OH_P_tran_2 
CDP-alcohol phosphatidyltransferase 2
This domain is found on CDP-alcohol phosphatidyltransferases. These enzymes catalyze the displacement of CMP from a CDP-alcohol by a second alcohol with formation of a phosphodiester bond and concomitant breaking of a phosphoride anhydride bond.
Statistics
?
PSSM-Id: 400390
View PSSM: pfam08009
Aligned: 39 rows
Threshold Bit Score: 37.8389
Threshold Setting Gi: 500322386
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_023788452  218 EWVLPIFILVMLALACLVTYPYATLAIASIVYLGFIP 254 Hyphomicrobium nitrativorans
jgi:Swit_0459 201 aWRLPALLLVAMLGAALFNAPWHTLSVFMLGYLATVP 237 Sphingomonas wittichii RW1
BAK66217      206 aWRMFALLLAGVFAAMLMVAPWHALLALTLGYLALIP 242 Sphingobium sp. SYK-6
Q2GEF5        200 YLESALIFLFVTIAVALILKPWLTISVLALCYICSMP 236 Neorickettsia sennetsu str. Miyayama
Q9ZDT3        177 EYLSLAMILVAIVIINLIIYPWYSLPLIAVIYILSIP 213 Rickettsia prowazekii
Q2GG55        204 NLSYIFILLFGIFIVFAITKPWITFPVVGMMYILSIP 240 Ehrlichia chaffeensis str. Arkansas
WP_012658913  211 RWFYMLVTILAVLMVLAITNPWVILPLMGVLYFVSIP 247 Anaplasma marginale
Q2GKG6        193 RLSYLFITLLAVLMVLAITNPWITFPIMGFTYLMSIP 229 Anaplasma phagocytophilum str. HZ
WP_013832682  212 DLRIGLIAVVGLTVAALLTEPWYTLAVITLGYLALIP 248 Novosphingobium sp. PP1Y
WP_013040632  204 rIRLEAIALAGLLAALLITDPWLTLLALCAFYLALIP 240 Sphingobium
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap