Conserved Protein Domain Family
DUF1699

?
pfam08004: DUF1699 
Protein of unknown function (DUF1699)
This family contains many archaeal proteins which have very conserved sequences.
Statistics
?
PSSM-Id: 369645
View PSSM: pfam08004
Aligned: 38 rows
Threshold Bit Score: 153.5
Threshold Setting Gi: 505126842
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
HusnBIG:Mpsy_2275   1 MKIRVVSSKDEINTLSSNEQIVHLAFRPSNTDILTMVTKCPKMKALHVPPSYKKTISKSTEMFLEMRGIALIEGDVWGHR 80  Methanolob...
WP_015313938        1 MRIKVIKSLEEINTL-KGASIVHISFRPSRDDILAIHKACPKLKAIQLPPSHFNTLSISASYYLKIVGITLIKGNIIRIV 79  Methanomet...
Q8TII7              6 IRIRVVTNRDEILSLEHEEKAVHLAFRPSDRDLFSLVKTCPGIEILQLPASSYEGLSKFIKMFLTSSGIHLVKGDVSGHW 85  Methanosar...
WP_014587811        1 MRIRVVSSKDEIAELNPNERIVHLAFRPSNVDFLDLMRSCPRLRAVQVPPSYHKTMSKAIKLFLEMQGIDLLEGDVWGHR 80  Methanosae...
sklmb:Mhar_1144     1 MKIRVVSQRSEIADLSPNERMVHIAFRPSNVDLLDLIKACPRLRAIQVPPSYNKTLSKAIRLFLQMQGIDLLEGDVWGHR 80  Methanosae...
sklmb:Mhar_2282     1 MKIRVVSSKDEITKLGPNERNVHLAFRPSNVDFLELIRVCPRLRTIQVPPSYHKTLSRAIRLFLEMQGITLLEGDVWGHR 80  Methanosae...
WP_014587809        1 MKLRVVSSKKEIPELNPNERIVHLAFRASNVDFLTLMKRCPRLRAIQVPPSYRRTISQAIQVFLDMQGISLLEGDVWGHR 80  Methanosae...
A0B915              1 MRIRVVSSKSEIAQLNPNERMVHLAFRASNVDFLNLMQRCPRLRVIQVPPSYKKTMSNAIQVFLEMQGIELLEGDVWGHR 80  Methanothr...
WP_013720089        1 MRLRVVSARNEISNLNPNEKTVHLAFRASNVDFLNLMQRCPRLRMIQVPPSYRKTMSNAIQVFLDMQGIELLEGDVWGHR 80  Methanothr...
sklmb:Mhar_2244     2 IKIRIVSSKDEIKDLTRGDHTVHLAYRASSTDMFRLLQYSPRLRAVQVPPSYYRNMPTTARAFLETQGVEIIEGDVWGHR 81  Methanosae...
HusnBIG:Mpsy_2275  81 KDINEYSEISQSIYDRIDQYRADGLSDDEIEIKMVRELNMGPDLLRFILK 130 Methanolobus psychrophilus R15
WP_015313938       80 ENKNSEYTISKLIINKIRTKIIDGENDESIIQSFSEYENPSTELLQFLIH 129 Methanomethylovorans hollandica
Q8TII7             86 HDLNNYFVIPSYVLEKIKELEVQGRTEKEIIEEITNLRKISPDMVLHLLH 135 Methanosarcina acetivorans
WP_014587811       81 KDIDEYYVVDEEAIEEIGNLIKQGESIEDASAAIQRKTRLAPDLIRYIAK 130 Methanosaeta harundinacea
sklmb:Mhar_1144    81 KDIDEYYMVDEGAIERIGDLISSGESIDDAVAQVTMTTRLSPDMIKYIAK 130 Methanosaeta harundinacea 6Ac
sklmb:Mhar_2282    81 KDIDEYYIVDEEPIEEIGSLIREGESLEEAAAAIQRKTKLSADLIKYIAr 130 Methanosaeta harundinacea 6Ac
WP_014587809       81 KDIDEYYVVSEETIGEIEAMISRGATAEEAAEEITKRTRLAPDLIRYIAr 130 Methanosaeta harundinacea
A0B915             81 KDLDEYFTVSDTTIEEIRSMINKGVSFEQMAEELQKKARIGPDLIKYIVK 130 Methanothrix thermoacetophila PT
WP_013720089       81 KDLDEYFTVDDTTIDEIRSLAASGASMDEVANQIQKKARLGPELIKYIAR 130 Methanothrix soehngenii
sklmb:Mhar_2244    82 KDIDEYFVIDDEMIERITRLQSDGLKVEEISSRISWESKLSPAMVNYIIK 131 Methanosaeta harundinacea 6Ac
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap