Conserved Protein Domain Family
NABP

?
pfam07990: NABP 
Nucleic acid binding protein NABP
Many members of this family are putative nucleic acid binding proteins. One member of this family has been partially characterized and contains two putative phosphorylation sites and a possible dimerization / leucine zipper domain.
Statistics
?
PSSM-Id: 400378
View PSSM: pfam07990
Aligned: 17 rows
Threshold Bit Score: 430.731
Threshold Setting Gi: 565368297
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002283191        301 RAPSPCLTPIGGgRTAISEKRGINGSSSFNSVPPSMNESADLVAALSGMDLSTNGVI-DEenhlPSQIEQDVENHQSYLF 379  wine grape
XP_002881034        268 RVPSPCLTPIGSgRVSSNDKRNTSNQSPFNGVTSGLNESSDLVNALSGMNLSGSGGL-DE----RGQAEQDVEKVRNYMF 342  Arabido...
EES01743            314 RVPSPGLPPVGV-RITSNDKKLNCSPSPFNTVSSKAVGTDDILSALSNMKLSKSGSLnDNnnisRSNFQRDISDQQKFSL 392  sorghum
BAS75191            288 RVPSPGLPPVGV-RINSNEKKLNCS-SSFNTASSKAVEPDDILAAISNMNMSKDGTLgDSnsisQSKFQSEISDHQNISL 365  Japanes...
ERM94832            308 RSPSPCLPPAGG-RHSAIEKKAIVGSNAISGISSSVTDIVDIATSLSGLNLSKNRLL-DEksrlHPQ--QGMIDHEKFLF 383  Amborel...
XP_010658380        319 RLPVSGLPPVSN-RVYPVEK-NIVDMNVQNGRSSSMTELSNITATLSGLSMSRNRCV-DEnshlQSQLHAEFDDQSDFLL 395  wine grape
EEF31455            318 RCPSSGLPPVGS-KVAFLEKKNAVGSTAQNGHLSGITELGEITATLSGLNLSKLRHP-EQds------liELDNQADFLF 389  castor ...
EES06026            306 RTPSPCLPPVGV-RMGSSDKKVEAA-----AVASLNHDGADIAATLSSLSLSGNK-MsNVenevQNHVYQNFGDQADVLF 378  sorghum
WGS:AAAA:OsI_09469  302 RTPSPCLPPVGV-RMGSTDKKVDGS-----AVASHNHDTADIAAALSSMNLSGSK-MaSLeaevQNRAYQNFGDQTDVLF 374  long-gr...
XP_009396181        310 RSPSPCLPPVGV-RNSDSDR-----SNGLGGVSSHMADYGDLVSALSDFNLSGKISL-DGechvPAQLDEQFRNQTELLY 382  wild Ma...
XP_002283191        380 NLQGGQSNIKQHSYLKKSESGHlqipsapqsgkasysdsvks--ngvgselnnslmadrqaelhKSSVPSGNSYLKGSSM 457  wine grape
XP_002881034        343 GMQGGHNEVNQHRFPNKSDQAH------------------------------------------KATGSLRDSQLRGPQG 380  Arabido...
EES01743            393 DSQGAQVHNKQHSVMLETDDGYlgipsmsqpsnssfadvnnsvaglaefrnttntrldgrsemqRSSNLSARSYQKSPSS 472  sorghum
BAS75191            366 DPKALQVNKNQHSLMLEADTDYlgippisqpsnpsfsdinknvsglanirnstntridghaemqRSSTLSTRSYQKSPTS 445  Japanes...
ERM94832            384 RVQNGH-QSQQHQLVNNSENGPlhppsisqspayaklidsng---nindhsiskmgsdgladwaKGT-SSVSLYPKAPSS 458  Amborel...
XP_010658380        396 NMPNGNSQSVQQQLTDKSKAAKpytstnyldlarkn---------------rivtdldgqinfpKRTFSSASLYSKV-NS 459  wine grape
EEF31455            390 NTSDGYNH-LQQQLRDKSNAENfsfsasyidvamkngam--------pnlnasefntngevsipKRTSSFTNLHSKL-NS 459  castor ...
EES06026            379 NVPKDHRQFSQQNLTQNTNEDSlnapeyavfpnggsnfs---------nlhasklashrnskfpMQS-PHGNANKKGSLM 448  sorghum
WGS:AAAA:OsI_09469  375 SVPKERRQLSQQKLAQNADEESinaleyaafpngsgnfn---------nsnmsklsvdsrskfpIQS-PHGNANNKGSLV 444  long-gr...
XP_009396181        383 D--GDNRQYLQQKVIDKPMSPLlknstnvvgysdpskrtss-----lteiglseltsdgqmnlpKQP-SYTNVYKKVPSV 454  wild Ma...
XP_002283191        458 SSHNGGGGLPSHYQQfV--DSTNssipnYGLGAYSMNPALASMMASQLGaanlpplfenvaaas-amgvpgidsrvlgag 534  wine grape
XP_002881034        381 SAYNGGVGLANPYQH-L--DSPN-----YCLNNYALNPAVASMMANQLGnnnfspmydnvsaasalgfsgmdsrlhgggf 452  Arabido...
EES01743            473 SNESPG-GSPAQHHS-F--DSINsaflnYGLSGYPLSPGLPSMMpplfesaaaasaia---------slgadsrnlgnhs 539  sorghum
BAS75191            446 SNASPG-GSPAQHQN-I--DNINsaflnYGLGGYPLSPGLPSMMMNCMGsgnmpplfesaaaasaiasfgadsrnlgnni 521  Japanes...
ERM94832            459 SSASNFDGSSTLYQN-S--NSQNaglqnFNLNGYSMNQMSLSSTNSH--------------------------------- 502  Amborel...
XP_010658380        460 SGLSSLEGPS--YQN-A--NIPSidftgHVPSGYHVNQKLNTMINNH--------------------------------- 501  wine grape
EEF31455            460 SGLGGLQRSNGHLQN-A--NIPSmnfvsHSPGAYTSNQKLDSLLKNH--------------------------------- 503  castor ...
EES06026            449 SSA----GSVSHYQN-LngDSHGidvsgRHMKTHAGGFT-SSMLN----------------------------------- 487  sorghum
WGS:AAAA:OsI_09469  445 SPT----GSVSLYQN-LngDNSNidvsvRNNKIRSSSFG-SSMLNNQLS------------------------------- 487  long-gr...
XP_009396181        455 GTT----ISKSLYPN-A--DVPNidfsgSNSKSYTGGHGLQTMVNNRLD------------------------------- 496  wild Ma...
XP_002283191        535 LASGPnigaatSESQNLNRIGNHMa--GNALQAPFVDPMYLQYlrta-eyaAAQVAALNDPSVDRNYLGNSYVDLLGLQK 611  wine grape
XP_002881034        453 VSSGQn----lSESRNLGRFSNRMmggGTGLQSHMADPMYHQY--------ADSLDLLNDPSMDMNFMGSSYMSMLELQR 520  Arabido...
EES01743            540 LSSSTls---lTDAHNLGRGGNQA---PTGLQSPLSDPFYVQYlkat-qyaAQGAGSYGDPSLERGYMGNSYANLNAVQK 612  sorghum
BAS75191            522 LSSPTls---lSDVHNLGRTGNQT---ATGLLSPLSDPFYVQYlkat-qyaAQGTANCSDPSLERGFMGSQYGDLTAVQK 594  Japanes...
ERM94832            503 FCTGAtls-etNDVQSMNRAVNQV---GAGLQMPLMDPLYLQYmqraveyaGHVTGNLGDPSAGRNYMGNSYVDLLGLQK 578  Amborel...
XP_010658380        502 NDSGPals-gsGDGQSLSRSGNWV---SSDLHS-YMEPHGVHYmqgtsdyaTRTAASQGDPSSVRNFIGTSHGDLLGLQK 576  wine grape
EEF31455            504 LDAGSalg-gnGVGHSLNRAGDQA---GPEFHSQVMDSRYAQYlrrtsdyeTRTNGQL------RNFFGISHGDLDEVQK 573  castor ...
EES06026            488 -----------PDGDYGNVLSNHG---GSSYQGQPTETMYAQYlqanpdspLGSAASM-SPFQGRGFTGSGHLDSPGYQK 552  sorghum
WGS:AAAA:OsI_09469  488 -----------ADGEYVNLLSNQG---GSGFQGQPMESMYAPYlqansdspLGAATNL-NPFQGSSFSGSVPLDSPGYQK 552  long-gr...
XP_009396181        497 -----------EEGQYLNTSGNQV---GSGFQGPIMDSLYAQYlrstsdslVRGPGNL-DHYSGMNYLGSSQMNLPEYQT 561  wild Ma...
XP_002283191        612 AYLGallSpQKSQYGVPLgsKSSGSNhHGYYGNP-AFGV-GMSYPGSPLASPVIPNSPIGPGSPIRHNDLNMRYPSGMRN 689  wine grape
XP_002881034        521 AFLG---A-QKSQYGLPY--KSGSPNsHSYYGSP-TFGS-NISYPGSPLAHHLLPNSLVSPCSPMRRGEVNMRYPSAARN 592  Arabido...
EES01743            613 AYIEallQqQK-QFEMPLlgKSTTSN-HGYYGNL-AFGM-GMAYPGSPLNSPV--ASQSGPGSPLRLGERNLRFPSNLRN 686  sorghum
BAS75191            595 AYIEallQqQK-QYGMPl-gKSTTSN-HGYYGNL-AFGM-GMAYPGSPLGSPV--ASPSGPGSPLRLSERNMRFPSNLRN 667  Japanes...
ERM94832            579 AYLGl-lAqQKSQYAMPFlsKSDGLN-HGYFGNG-SCGV-GMQYSEFPVANSLLSAS-LGVGNPIRQGERNHRFPA-MRS 652  Amborel...
XP_010658380        577 AYLEtllAqQKQQYELPLlgKSGGLN-QGYYGNS-SYGL-GMAYPGNPMANSALPS--VGSGNPMFQNDQISCFTSMMRS 651  wine grape
EEF31455            574 AYLEallAqQNQQYE-PLlvKSGSMN-QGYHRNS-SYGL-GMPYLGTSMANSVLPS--VGSGS--FQNEQVAHFTSTVRN 645  castor ...
EES06026            553 AYLGslfAqQKLQYGIPYlgKSGALN-QNIYGNDpAFGI-GMTYLTSPPSSPYISSPQ----GHVRQGDRLTRLPAVVRN 626  sorghum
WGS:AAAA:OsI_09469  553 AYIAsllAqQKLQYGVPYlgKSGSLS-PNIYGSDpAFGIgGMAYLSSPTSTPFISSPQ----GHVRQGDRLARISSVGKT 627  long-gr...
XP_009396181        562 AYLGallAqQKLQYSMPLlsKSGGLN-HGFSSSH-AFGI-GMPYPGSPSSTT-IHSPNLGSGSPVRLNERLSRIPSSMRS 637  wild Ma...
XP_002283191        690 LAGGVMAPWHLDAgcNMDEGFASSLLEEFKSNKTKCFELS 729  wine grape
XP_002881034        593 YSGGVMGSWHMDA--SLDEGFGSSMLEEFKSNKTRGFELS 630  Arabidopsis lyrata subsp. lyrata
EES01743            687 -----LGGWNSDPsgYMNENFPSSLLDEFKSNKARSFELA 721  sorghum
BAS75191            668 -----LGGWNSDPsgYMNDNFPSSLLDEFKSNKARSFELA 702  Japanese rice
ERM94832            653 -SAGATGSWHSENggNMEDCFASSMLDDFKSNKMKCFELS 691  Amborella trichopoda
XP_010658380        652 SMGGPITSWHTDTs-NMEGRFASTLLEEFKNNKTRSFELS 690  wine grape
EEF31455            646 SMGGSIGSWHPDVgsNIERRYVSSLLDEFKNNKTRSFELS 685  castor bean
EES06026            627 TAGGSMGSWSSENg-LMDNG-GSSLLEEFKTNKTRSFELl 664  sorghum
WGS:AAAA:OsI_09469  628 TTGGPMGSWNSDNg-LIDNGYGSSLLEEFKTNKTRSFELl 666  long-grained rice
XP_009396181        638 APGGSIGSWITENg-TMKEGYMSSLLEEFKNNKTRSFELS 676  wild Malaysian banana
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap