Conserved Protein Domain Family
LMSTEN

?
pfam07988: LMSTEN 
LMSTEN motif
This region of Myb proteins has previously been described as the transcriptional activation domain present in the vertebrate c-Myb and A-Myb, but neither vertebrate B-Myb proteins nor Myb proteins of invertebrates. Because vertebrate B-Myb (but neither A-Myb nor c-Myb) can partially complement Drosophila Myb null mutants, this region appears to have been a relatively recent insertion.
Statistics
?
PSSM-Id: 400376
View PSSM: pfam07988
Aligned: 7 rows
Threshold Bit Score: 76.0228
Threshold Setting Gi: 847137827
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_006006862 241 CMEtELQSNLAFVQQPFIE-DDPDKEQRIKELELLLMSAESEVRRKR 286 coelacanth
RLW12924     244 CLE-HTPSSSNIVQQPFID-DDPDKEKKIKELELLLMSAENEIRRKQ 288 Gouldian finch
XP_008112743 269 IVN-VPQPAAAAIQRHYND-EDPEKEKRIKELELLLMSTENELKGQQ 313 green anole
NP_571341    259 ILN-FPQHGTAAIQRHYSD-EDPEKEKRVKEIEMLLMSTENELKGQQ 303 zebrafish
XP_004011761 242 CVE-HVQASSAFIQQPFVD-EDPDKEKKIKELELLLMSAENEVRRKR 286 sheep
XP_023284496  11 ILN-IPQHGTAAIQRHYNE-EDPEKEQRVKEIELLLMSTENELRG-Q 54  Seriola lalandi dorsalis
XP_012820719 199 CIE--IQKSFSFIQQPFVDeDDPDKEKRIKELELLLMSAENEVRRKR 243 tropical clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap