2PSG


Conserved Protein Domain Family
A1_Propeptide

?
pfam07966: A1_Propeptide 
Click on image for an interactive view with Cn3D
A1 Propeptide
Most eukaryotic endopeptidases (Merops Family A1) are synthesized with signal and propeptides. The animal pepsin-like endopeptidase propeptides form a distinct family of propeptides, which contain a conserved motif approximately 30 residues long. In pepsinogen A, the first 11 residues of the mature pepsin sequence are displaced by residues of the propeptide. The propeptide contains two helices that block the active site cleft, in particular the conserved Asp11 residue, in pepsin, hydrogen bonds to a conserved Arg residues in the propeptide. This hydrogen bond stabilizes the propeptide conformation and is probably responsible for triggering the conversion of pepsinogen to pepsin under acidic conditions.
Statistics
?
PSSM-Id: 400357
View PSSM: pfam07966
Aligned: 124 rows
Threshold Bit Score: 28.4485
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2PSG_A         1 LVKVPLVRKKSLRQNLIK-DGKLKDFLKTH 29  pig
ETN60836      28 LVRVTLHKAPSAREHFRSvGTEIKQLRLKY 57  Anopheles darlingi
Q03168        20 FVRVQLHKTESARQHFRNvDTEIKQLRLKY 49  yellow fever mosquito
XP_002427417  19 LIRVPLYKFQSARRTLRGvGTDVEHLRMRY 48  human body louse
XP_001600543  19 VLRVPLYRVKSARRTLQEvGTELHQIKLRY 48  jewel wasp
EFN82801       9 LLRIQLHKTESIRRILQEvGTDLHQVRLYG 38  Jerdon's jumping ant
EEZ99098      19 FVRVPLYKVKSARRSLQEvGTHVQQVRMRY 48  red flour beetle
EDO49162       1 FYRIPLHKMPTPRQSLKEvGISVEQLLGKY 30  starlet sea anemone
P52115        25 FRRIFLKKMPSVRESLKErGVDMAQLGAEW 54  sheep
XP_022594824  24 LRRVTLKKMPSIRETLQEmGVSAEQVLTEL 53  greater amberjack
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap