Conserved Protein Domain Family
CBP4

?
pfam07960: CBP4 
CBP4
The CBP4 in S. cerevisiae is essential for the expression and activity of ubiquinol-cytochrome c reductase. This family appears to be fungal specific.
Statistics
?
PSSM-Id: 369619
View PSSM: pfam07960
Aligned: 34 rows
Threshold Bit Score: 110.06
Threshold Setting Gi: 557729850
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAY70058       7 SYLLWKKSLIYGGGIIGTGVLLYKFTTPTEEQLIARLSPELRQEYEQNKSLRRKEQEELMKIVRETSKSNDPIWKTGPLT 86  Komagataella ph...
XP_011277656   5 LWYRWARVYAVGASIVGFGVVAYLYATPTDEELINRLSPELRAQYERERGLRRKEQEELIKIVKQTSASQDPIWMTGPIK 84  Wickerhamomyces...
Q6C5S0        17 GVPNWPKFGLFAVGVIGSAYLGYRYATPSEEDIVRRMNPELRERYMLERDARQEYFNEFVKEAIAQSKTNEPIWKVGPMA 96  Yarrowia lipoly...
CDP23810       5 NWWLWTKMLVAGGGVIWGGPALVRYLQPTDEELFQKYNPELQKRSLERRYEREKEFDDFVVKLKEQAKSDKPIWIL---- 80  Podospora anser...
A4RC22         7 NYKLWAKMILGGAGIAVGGPAFVMYISPTEEELFKRYNPDLQKRALESRYERQKEYDDFVTELKKSAKSDKNIWITQQI- 85  Pyricularia ory...
EGV64103       7 RWKKVLRAGIYGNAVILLGVVLFKYTTPTEEQLISRFSPEIRADYEKNRSFRQQEQQELMKIVRETSQSSDPVWKTGKIK 86  Yamadazyma tenu...
XP_002616659   6 TWPKLGRMLLYGGGIIGTGVLLFTYTVPTDEQLIAAFSPEVRANYEKNKALRQKEQEELMKIVQETSKSNDPIWKTGKIA 85  Clavispora lusi...
A5DM93         6 LWYRWARVGFYGGAIIATGVVLFKYTTPTDEQLIASFSPEVRAEYEKSRELRQKEQQALMEIVKKTSASNDPIWKTGSIK 85  Meyerozyma guil...
CCE88905       6 VWYRWARVFVVGGAIIGTGVTLFKYTVPTDEQLIAQFSPEIKEEYLKNRELRRREQQALMELVKETSASNDPIWMTGKIK 85  Millerozyma far...
Q6BI17         6 LWYRWARVGVVGFSIIATGSLLFKYTVPTDEQLIAKFSPEIRAEYERNREIRQKEQQELMKIARETAASDDPIWKTGRIK 85  Debaryomyces ha...
CAY70058      87 PSWESsatgptdrlpKGKELLVaKQAFEKSQAEEKQKEELRLLKKQVEETSQLES 141 Komagataella phaffii GS115
XP_011277656  85 SPLEN----------HGTQLADvKQQYEKQVAEQKQLQEIEQIRAELEETQRKTK 129 Wickerhamomyces ciferrii
Q6C5S0        97 SK-------------PIDFNVAvREKMKEIEARNDQDRN-ERIKNELAAIAKKEE 137 Yarrowia lipolytica CLIB122
CDP23810      81 ---------------QAEEEKAsATNMARQQKLAESLRLAEEVKARREAMRKEag 120 Podospora anserina S mat+
A4RC22        86 ---------------EAEKKEKlARQMASANAAAEQARMQEEEHAKIEQMRREag 125 Pyricularia oryzae 70-15
EGV64103      87 SPFEKdt-------rGLDPKLVdVKVFEKQEALAYQREQIDKSTEELAETEKLLA 134 Yamadazyma tenuis ATCC 10573
XP_002616659  86 SPFEKet-------rGADPKLVnATQFFKEEADAKKKAETERAEAEFLETERLVS 133 Clavispora lusitaniae ATCC 42720
A5DM93        86 SPFEKdg-------rYVDPKLVdPQALLRESAAEQQRIETEEANRKMEETERLLN 133 Meyerozyma guilliermondii ATCC 6260
CCE88905      86 SPFEReg-------rNTDPRLAtMEDSYRTEGEDARREEVLKASAELSETEDLLQ 133 Millerozyma farinosa CBS 7064
Q6BI17        86 SPFEKdg-------rNTDPKLVdIEKYNRERGDEFKKSEVERAQQELREAEELVS 133 Debaryomyces hansenii CBS767
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap