3FUQ,3FFZ,2VXR


Conserved Protein Domain Family
Toxin_R_bind_N

?
pfam07953: Toxin_R_bind_N 
Click on image for an interactive view with Cn3D
Clostridium neurotoxin, N-terminal receptor binding
The Clostridium neurotoxin family is composed of tetanus neurotoxin and seven serotypes of botulinum neurotoxin. The structure of the botulinum neurotoxin reveals a four domain protein. The N-terminal catalytic domain (pfam01742), the central translocation domains and two receptor binding domains. This domains is the N-terminal receptor binding domain,which is comprised of two seven-stranded beta-sheets sandwiched together to form a jelly role motif. The role of this domain in receptor binding appears to be indirect.
Statistics
?
PSSM-Id: 400348
View PSSM: pfam07953
Aligned: 13 rows
Threshold Bit Score: 171.423
Threshold Setting Gi: 728992
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3FUQ_A         17 NNKFIDISGYGSNISINGDVYIYS-TNRNQFGIYSSKPsEVNIAQNNDIIYNGRYQNFSISFWVRIPKYFNKv---nLNN 92   Clostridium b...
P0DPI1        885 SNHLIDLSRYASKINIGSKVNFDP-IDKNQIQLFNLESsKIEVILKNAIVYNSMYENFSTSFWIRIPKYFNSi---sLNN 960  Clostridium b...
Q3ZUA3         40 NDIISDISGFNSSVITYPDAQLVPgINGKAIHLVNNESsEVIVHKAMDIEYNDMFNNFTVSFWLRVPKVSAShleqyGTN 119  Clostridium s...
3FFZ_B        859 NDKYVDTSGYDSNININGDVYKYP-TNKNQFGIYNDKLsEVNISQNDYIIYDNKYKNFSISFWVRIPNYDNKiv--nVNN 935  Clostridium b...
2VXR_A         60 GGRLIDSSGYGATMNVGSDVIFND-IGNGQFKLNNSENsNITAHQSKFVVYDSMFDNFSINFWVRTPKYNNNdiqtyLQN 138  Clostridium b...
Q8GR96        872 DNNLIDLSGYGANVEVYDGVELND---KNQFKLTSSTNsEIRVTQNQNIIFNSMFLDFSVSFWIRIPKYKNDgiqnyIHN 948  Clostridium b...
Q841S3        880 KNALVDTSGYNAEVRLEGDVQVNT-IYTNDFKLSSSGD-KIIVNLNNNILYSAIYENSSVSFWIKISKDLTN-----SHN 952  Clostridium b...
Q9LBS8        847 SNIIEDISGKNTLIQYTESVELVYgVNGESLYLKSPNE---TVEFSNNFFTNGLTNNFTICFWLRFTGKDDD-------- 915  Clostridium b...
WP_003404192  847 NKVIEDISGKNTLVKYSDSISLVYgVNGDALYLKEPDE---SVSFSNKAFENGLTNSFSICFWLRNLGEDII-------- 915  Clostridium b...
O06018        848 RKVIKDISGKDTLVQYSDTIDLSYgVNGDALYLKEPNQ---SVNFSNNIFENGLTNSFSICFWLRNLGQDNL-------- 916  Clostridium b...
O69276        816 NNAIGDASGKNTSIEYSKDIGLVYgINSDALYLNGSNQ---SISFSNDFFENGLTNSFSIYFWLRNLGKDTI-------- 884  Clostridium b...
O87710        811 KNVIGDGSGKNTLVEYTNDIGLIYgINNNALYLNQSNQ---SVSFTNDYFENGLTNSFSIYFWLRNLGKDII-------- 879  Clostridium b...
Q06366        812 NNVIGDTSGKNTLVEYPKDIGLVYgINNNAIHLTGANQ---NIKFTNDYFENGLTNNFSIYFWLRNLNQNTI-------- 880  Clostridium b...
3FUQ_A         93 EYTIIDCIrNNN----SGWKISLNYNKIIWTLQDTAGNNQKLVFNyTQMISISDYI-NKWIFVTITNNRLGNS-RIYING 166  Clostridium b...
P0DPI1        961 EYTIINCM-ENN----SGWKVSLNYGEIIWTLQDTQEIKQRVVFKySQMINISDYI-NRWIFVTITNNRLNNS-KIYING 1033 Clostridium b...
Q3ZUA3        120 EYSIISSMkKYSlsigSGWSVSLKGNNLIWTLKDSAGEVRQITFR-DLSDKFNAYLaNKWVFITITNDRLSSA-NLYING 197  Clostridium s...
3FFZ_B        936 EYTIINCMrDNN----SGWKVSLNHNEIIWTLQDNAGINQKLAFNyGNANGISDYI-NKWIFVTITNDRLGDS-KLYING 1009 Clostridium b...
2VXR_A        139 EYTIISCI-KND----SGWKVSIKGNRIIWTLIDVNAKSKSIFFEySIKDNISDYI-NKWFSITITNDRLGNA-NIYING 211  Clostridium b...
Q8GR96        949 EYTIINCI-KNN----SGWKISIRGNRIIWTLTDINGKTKSVFFEySIREDISDYI-NRWFFVTITNNS-DNA-KIYING 1020 Clostridium b...
Q841S3        953 EYTIINSI-KQN----SGWKLCIRNGNIEWILQDINRKYKSLIFDySESLSHTGYT-NKWFFVTITNNIMGYM-KLYING 1025 Clostridium b...
Q9LBS8        916 KTRLIGNK-VNN----CGWEIYFEDNGLVFEIIDSNGNQESVYL--------SNVInNNWYYISISVDRSKDQlLIFIND 982  Clostridium b...
WP_003404192  916 TSKLIENK-ADN----CGWEIYFENNGLVFSIVDCNGNEENIYL--------SDVIsKNWYYISISIDRLRNQlLIFIND 982  Clostridium b...
O06018        917 SSNLIGNI-VNN----CGWQIYFENNGLVFSMVDCNGNEKNIYL--------SDVLsKYWYYISVSVDRLRNKlLIFIND 983  Clostridium b...
O69276        885 KSKLIGSK-EDN----CGWEIYFQDTGLVFNMIDSNGNEKNIYL--------SDVSnNSWHYITISVDRLKEQlLIFIDD 951  Clostridium b...
O87710        880 KSKLISSK-LDN----CGWEIYLEDNGLVFNIIDSNGSYKKIYI--------SDMn-NSWNYIAISVDRLKEQlLIFVND 945  Clostridium b...
Q06366        881 KSKLIGSK-EDN----CGWEIYFENNGLVFNIIDSNGNEKNIYL--------SNISnKSWHYIVISINRLKDQlLIFIDN 947  Clostridium b...
3FUQ_A        167 NLIDEKSISNLGDIHVSDNILFKIVGCND-TRYVGIRYFKVFDTEL 211  Clostridium botulinum
P0DPI1       1034 RLIDQKPISNLGNIHASNNIMFKLDGCRDtHRYIWIKYFNLFDKEL 1079 Clostridium botulinum A str. Hall
Q3ZUA3        198 VLMGSAEITGLGAIREDNNITLKLDRCNNnNQYVSIDKFRIFCKAL 243  Clostridium sp. RKD
3FFZ_B       1010 NLIDQKSILNLGNIHVSDNILFKIVNCSY-TRYIGIRYFNIFDKEL 1054 Clostridium botulinum
2VXR_A        212 SLKKSEKILNLDRINSSNDIDFKLINCTDtTKFVWIKDFNIFGREL 257  Clostridium botulinum
Q8GR96       1021 KLESNIDIKDIGEVIANGEIIFKLDGDIDrTQFIWMKYFSIFNTEL 1066 Clostridium botulinum
Q841S3       1026 ELKQSERIEDLNEVKLDKTIVFGIDENIDeNQMLWIRDFNIFSKEL 1071 Clostridium botulinum
Q9LBS8        983 KNVANVSIEQILNIYSTNVISL-----VNkNNSIYVEELSVLDKTV 1023 Clostridium botulinum
WP_003404192  983 KLIANQSIEQILNIYSSNTISL-----VNeNNPIYIEGLSILNRSI 1023 Clostridium botulinum
O06018        984 KLIVNESIEQILNIYSSNIISL-----VNeNNPICIEELSILNKAL 1024 Clostridium botulinum
O69276        952 NLVANESIKEILNIYSSNTISL-----VNeNNPIYVEGLSILNKPT 992  Clostridium botulinum
O87710        946 VLVANEDIKDILNIYSSNTISL-----VSeNNQICIEGLSILNTNI 986  Clostridium baratii
Q06366        948 ILVANEDIKEILNIYSSDIISL-----LSdNNNVYIEGLSVLNKTI 988  Clostridium butyricum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap