Conserved Protein Domain Family
DAP_B

?
pfam07930: DAP_B 
D-aminopeptidase, domain B
D-aminopeptidase is a dimeric enzyme with each monomer being composed of three domains. Domain B is organized to form a beta barrel made up of eight antiparallel beta strands. It is connected to domain A, the catalytic domain, by an eight-residue sequence, and also interacts with both domains A and C via non-covalent bonds. Domain B probably functions in maintaining domain C in a good position to interact with domain A.
Statistics
?
PSSM-Id: 400333
View PSSM: pfam07930
Aligned: 20 rows
Threshold Bit Score: 229.478
Threshold Setting Gi: 81351974
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003857145 351 ITPSPKWTGAYLNPQNNLLLTVvpSPGKP-STLSVTYAVAPA--EVTLASPTTAESAGMLA----SIApssssdvspQQN 423 Zymoseptoria tr...
EPS33454     351 VHVNQDFLGTFFDPEARLSCPV--QEGES-GTIVIRYSDHEE--RVLLSSSNTGSTETLSV----ELG---------IDS 412 Penicillium oxa...
GAA90251     562 smPAPNWAGIYFDPDAQLVVEV--RLGGP-GEVIVTYTGDDE--TLKLTEEFEAQSDLATA----TLC---------SDI 623 Aspergillus kaw...
EKV19121     354 VQATADWVGAFLDQDTQLSIVI--TKGAQdGEVAITYDGSAD--TIKLSTPNHGRSNSAVA----TVD---------GDS 416 Penicillium dig...
EPS32712     351 VEPAPAWYGAYLDEATQLAVTV--AKSRRpGEVLITYGSHLEsaPLKMTDATSGKSRSMTG----SIS---------GDT 415 Penicillium oxa...
Q5FRJ7       341 TQQPTALYGTYLERETGLSARI--EPAPG-G-AKLRYLMVPE--LLEGISATRAEAGSVVVkaqeTAE---------GAE 405 Gluconobacter o...
A6WYS5       340 VAADAVWFGSWLDHETGLVLSL--EDAGR-GRMKARFGTGPE--MMDVVGENEARSSMTAI----RRD---------GDT 401 Ochrobactrum an...
Q2YLB4       340 AQANPGWFGSWLNPETGLVLSL--EDAGG-GRMKARFGTGPE--IMDISGENEAQSSMTTL----RRD---------GDM 401 Brucella abortu...
WP_020952221 339 pQAALGWDGLWMDDEQGLFIRT--TSTPA-G-VKLNYQHTAQ--MLTPTSDSRAEFHGITL----ERG---------PEG 399 Paracoccus amin...
EME86870     346 HAPSPEWNGSFLDEATQLLIKV--ESEND-KEVVIAYAGHEE--KPQLTGPSTAESKTMLA----SIN---------GDT 407 Pseudocercospor...
XP_003857145 424 LSITRLRENTIFQARRLPEPSVPp--pSSIDLAGEYHCAEV-QSSLRITsAskHSGLMYGAFSGFMGNGPVALMKYVAGE 500 Zymoseptoria tr...
EPS33454     413 VRLYRRDDNRLVVARRIVASEKS----VKGDYTGTYECKEL-ESVFTCS-G--TCDMLYGSFQGYLGHGPMHLMRYLGED 484 Penicillium oxa...
GAA90251     624 LIIHRKYENRNIQAKRIIAGQQA----PKGDYVGRYHCTEM-DSIFLCS-G--AGGMLYGSFKGFLGHGPAELMRYLGDD 695 Aspergillus kaw...
EKV19121     417 LSIHRVGDNRILSARRIAPKESIl---RDNSFQGVYHCTEI-ESTFHCN-G--EDGMLYGAFDGYLGQGHATPMKYLGDD 489 Penicillium dig...
EPS32712     416 LQIHRISENRKLNARRLVPLDSGl---VDPKLAGAYYCDEI-ESTFYCT-G--EAGMFYGTFDGYLGNGIVTSMRYLGDD 488 Penicillium oxa...
Q5FRJ7       406 AVMERPGENRTSILARCDETPGE----DIAELAGVYRCEELdEAEVTIE-L--AGGVVYGGFSGILGDGRMEMLQRLAKD 478 Gluconobacter o...
A6WYS5       402 IHLAREDENLSLTMQRLKGA-------AKQDIAGHYRSDEL-EADLLIV-D--EGGAFYGAFEGFLGKSDMYSLYEAGPD 470 Ochrobactrum an...
Q2YLB4       402 IHLARKDENLHLAMHRLKGE-------ARQDIAGRYRSDEL-EADLLLV-S--EGGAIYGAFEGFLGKSDMYPLYAAGPD 470 Brucella abortu...
WP_020952221 400 LTMRREDENLSVTGRPVPRLDFA----DGTEIAGRYLASES-GATLEIA-S--RDGGTYIGCSGMLGTGPMERAYAIAPD 471 Paracoccus amin...
EME86870     408 LNIERKREHRMLKAARVPKVERTdldgSVEECIGEYRCEES-DSILRCT-G--AGGVLYGFFAGFLGQGPLHIMRPVAKD 483 Pseudocercospor...
XP_003857145 501 VWTLACPRGLDAPAPGDWTCVFQRGDDGTVDEVTIGCWLARNLKF 545 Zymoseptoria tritici IPO323
EPS33454     485 IWVLVCPRGLDAPAPGNWTLVFHRDGDGAITGVTMGCWLARNVKF 529 Penicillium oxalicum 114-2
GAA90251     696 IWFLVCARGLDAPAPGNWTVVFQRDVQGEVVGVTFGCWLARKITF 740 Aspergillus kawachii IFO 4308
EKV19121     490 VWVLTCPRGLDAPAPGDWTIVFSRDEHNVIQGFTIGCWLARKVDF 534 Penicillium digitatum PHI26
EPS32712     489 VWALGCPRGLDASAPGDWTMVFQRDESGTVSGFKIGCWLARGLDF 533 Penicillium oxalicum 114-2
Q5FRJ7       479 VWVLPCPRALDHTAPGDWTLAFER-QGGSVTAVRVGCWLARDLMY 522 Gluconobacter oxydans 621H
A6WYS5       471 VWLLPVQRSMDAPSPGEWKLVFHRDAKGEITGMTVGCWLARHVDY 515 Ochrobactrum anthropi ATCC 49188
Q2YLB4       471 VWLLPVQRSMDAPSPGEWKLVFHRDAAGRITGVTVGCWLARGVEY 515 Brucella abortus 2308
WP_020952221 472 LWSMPSRRSMDASPPGEWTVEITRDAAGKVAGLVISNWLARKNIY 516 Paracoccus aminophilus
EME86870     484 IWLLADPRGMDAPAPGDWTVVFGRGEDGHIKSVSVGCWLARRLGF 528 Pseudocercospora fijiensis CIRAD86
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap